KEGG   Streptococcus sp. NPS 308: SNAG_1485Help
Entry
SNAG_1485         CDS       T05541                                 

Gene name
metF
Definition
(GenBank) 5,10-methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
strn  Streptococcus sp. NPS 308
Pathway
strn00670  One carbon pool by folate
strn01100  Metabolic pathways
strn01120  Microbial metabolism in diverse environments
strn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:strn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SNAG_1485 (metF)
Enzymes [BR:strn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     SNAG_1485 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR Chlam_OMP3
Motif
Other DBs
NCBI-ProteinID: BAV80354
UniProt: A0A1E1GC77
Position
complement(1457975..1458835)
Genome map
AA seq 286 aa AA seqDB search
MSRQTPSLSFEVFPPNPEVGNDKIIAALKDMQGLAPHFISVTASNNKFNIKETTVRLADY
IQNDLEIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGDIIPGVEPQKDFRYATD
LIEFITEQAPHFDIVGACYPEGHPDSPNQISDIQNLKKKVDAGCSSLVTQLFFDNERFYD
FQDKCTLAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRKFKAILDKYENDPESLRAA
GLAYAVDQIVDLVTQDVAGVHLYTMNNADTAQYIHQATHALFNHQP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtcaaacaccgtccctctcatttgaagttttccctccaaacccagaagtaggc
aatgacaaaattattgcagccctgaaagacatgcagggcttggcaccacacttcatcagt
gtgactgctagtaataataaatttaatatcaaagagacgacggttcgtttggcagactat
atccaaaatgatttggagatcccaaccattgctcacttgccagctatctatttgactaag
gataaggtggctgagaccattgcggatttggataaagttggtgttcagaaaatcttggct
cttcgtggggatatcattccaggtgttgagccacagaaggatttccgttacgcgactgac
ttgattgagtttatcactgaacaggcaccgcattttgatattgttggagcttgttaccca
gaagggcacccggattcgccaaaccaaatctcagatatccaaaatctcaagaaaaaagtg
gatgcaggctgttcaagtcttgttactcagctattctttgacaatgagcgtttctacgat
ttccaagacaagtgtaccttggcagggattgatgttcctattcatgcaggtatcatgcca
atcctcaatcgtaaccaagctcttcgtctcttgaagacttgtgagaatatccatctccca
cgtaagtttaaagccatcttagacaagtatgagaatgaccctgagtcactcagagcagca
ggacttgcctatgcagtagaccaaatcgtggacttggtaacgcaagatgtagcaggcgtg
catctctacaccatgaacaacgcagacactgctcaatatattcaccaagcaacccatgcc
ttgttcaatcaccaaccttaa

DBGET integrated database retrieval system