KEGG   Streptococcus sp. NPS 308: SNAG_1530Help
Entry
SNAG_1530         CDS       T05541                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
strn  Streptococcus sp. NPS 308
Pathway
strn00970  Aminoacyl-tRNA biosynthesis
strn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SNAG_1530 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:strn03029]
    SNAG_1530 (gatB)
Enzymes [BR:strn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SNAG_1530 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SNAG_1530 (gatB)
Mitochondrial biogenesis [BR:strn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SNAG_1530 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BAV80399
UniProt: A0A1E1GC78
Position
1506323..1507768
Genome map
AA seq 481 aa AA seqDB search
MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGI
KAALALNMDIHKHMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAG
ISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSG
GQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDLPLFEISDEWIEEMRTELPEFPKE
RRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALGGDAKQVSNWLQGEVAQFLNAEGKT
LEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGLVQISDPDVL
IPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKES
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcattggacttgaagtccacgtagagctcaacaccaattcaaaa
atcttctcacctacttctgcccactttggaaatgaccaaaatgccaacaccaacgtgatt
gactggtctttcccaggagttctgccagttctcaataaaggggttgtcgatgctggtatc
aaggcagctcttgccctcaacatggacatccacaagcacatgcacttcgatcgcaagaat
tacttctaccctgataatccaaaagcctatcaaatttcccagtttgatgagccaatcggt
tataacggttggattgaagtggagctagaagacggtacgaccaagaaaatcggtatcgaa
cgcgcccacttggaagaagacgctggtaaaaacacccacggtacagatggctactcttat
gttgacctcaaccgccaaggggtgccattgattgagattgtatctgaagcggacatgcgt
tccccagaagaagcctatgcttatctaacagccctcaaggaagtcatccagtacgctggc
atttctgacgttaagatggaagaaggttcgatgcgtgtggatgccaacatttcccttcgt
ccttatggtcaagaaaaattcggtaccaagactgagttgaagaacctcaactccttctca
aacgttcgtaagggtcttgaatacgaagtccaacgccaagctgaaatccttcgctcaggt
ggtcaaatccgccaagaaacacgccgttacgatgaagctaacaaggcaaccatcctcatg
cgtgttaaggaaggcgctgctgactaccgctacttcccagaaccagacctaccactcttt
gaaatctcagatgagtggattgaggaaatgcgtacagaattgccagagtttccaaaagaa
cgccgtgcgcgctacgtatctgaccttggcttgtcagactacgatgccagccagttgacg
gcaaacaaagtcacttctgacttctttgaaaaagctgttgccctcggtggcgatgccaaa
caagtctctaactggctccaaggtgaagtcgctcagttcttgaacgccgaaggtaaaaca
ctggaacaaatcgaattgacaccagaaaacttggtagaaatgattgccatcatcgaagac
ggtactatctcttctaagatcgccaagaaagtctttgtccacctagctaaaaatggcggt
ggcgcgcgtgaatacgtggaaaaagcaggcttggttcaaatctctgatccagatgttctg
attccaattatccaccaagtctttgctgataacgaagctgctgttgccgacttcaagtca
ggcaaacgaaacgcagacaaggccttcacaggattccttatgaaggcaaccaaaggccaa
gccaacccacaagttgctcttaaactccttgcacaagaattggccaagttgaaagaaagt
gagtaa

DBGET integrated database retrieval system