KEGG   Streptomyces sp. MOE7: STRMOE7_12230Help
Entry
STRMOE7_12230     CDS       T05374                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00790  Folate biosynthesis
stro01100  Metabolic pathways
stro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STRMOE7_12230
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STRMOE7_12230
Enzymes [BR:stro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     STRMOE7_12230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: ARH95228
UniProt: A0A1W5XZB4
Position
complement(2747995..2749611)
Genome map
AA seq 538 aa AA seqDB search
MRPAQAGAGAHVGRRRFLTATGAAAALAFATNLPGAGAAYAAEADARKITENPFTLGVAS
GDPQPGSVVLWTRLAPRPYEPSGGGMPPARVTVRWEVAYDEHFTRLAGRGRAEAHPEFNH
SVHIEPTGLAPDRVYYYRFRAGSWISPVGRTRTAPARSARLSELKLAAVSCQAYHDGYFT
AYRHLAQEDLDVVFHLGDYLYEYPVGAHGGARAYTDRTLPALFNRETVTLEDYRLRYALY
KSDPDLQAAHAAHPFIVTWDDHEVENNYASDISEDALPPAEFLIRRAAAYRAYWENQPLR
RPQRPDGPDARLYRRLQYGRLAQFDILDTRQYRSDQAYGDGWHTPGPESEDPRRTLTGAT
QERWLIDGWRQSTARWNVLPQQVTFAERRNATGPGYQVSMDAWDGYPASRERVLAGAEAA
GVDNLVVLTGDVHVHYAFDIKRDFTDPGSRTAGVEFVTTSISSGKNGADKPANWETYLAA
NPHMKFYNGRRGYLTVTLDEATARGDYRTVSAVTTPGAPVRTAASFVTEAGDPGLKPA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccggcgcaggcaggcgccggcgcgcacgtcggccgccggcgtttcctcaccgcc
accggagccgccgccgcactcgccttcgcgaccaacctgccgggcgcgggggccgcgtac
gccgccgaggccgacgcccgcaagatcaccgagaaccccttcaccctcggcgtcgcctcc
ggggacccgcagcccggctcggtggtgctgtggacccgcctcgcgccgcgcccgtacgag
ccgagcgggggaggcatgccgcctgccagagtcaccgtccgctgggaagtggcctacgac
gagcacttcacgcggctggccggccggggccgtgcggaggcgcacccggagttcaaccac
tccgtgcacatcgagcccaccggtctcgcgcccgaccgcgtctactactaccgcttccgg
gccggcagctggatcagccccgtcggccgcacccgcaccgcgcccgcccgcagcgcccgg
ctctccgagctgaagctcgccgcggtctcctgccaggcgtaccacgacggctacttcacg
gcgtaccggcacctggcgcaggaggacctcgacgtcgtcttccacctcggcgactacctc
tacgagtacccagtaggcgcgcacggcggcgcccgcgcctacaccgaccgcacgctgccc
gcgctgttcaaccgcgagacggtcacgctggaggactaccggctgcgctacgccctctac
aagtccgacccggacctccaggccgcgcacgccgcgcaccccttcatcgtcacctgggac
gaccacgaggtggagaacaactacgcctccgacatcagcgaggacgccctcccgcccgcc
gagttcctcatccgccgggccgccgcctaccgcgcgtactgggagaaccagccgctgcgc
cgcccgcagcggcccgacggccccgacgcccggctctaccggcgcctgcagtacggccgg
ctcgcccagttcgacatcctcgacacccgccagtaccgctccgaccaggcttacggcgac
ggctggcacaccccgggcccggagtccgaggacccccgtcgcacgctgaccggcgccacc
caggagcgctggctgatcgacggctggcggcagtccaccgcccgctggaacgtgctgccg
cagcaggtcaccttcgccgagcggcgcaacgcgaccggccccggctaccaggtcagcatg
gacgcctgggacggctacccggcctcccgcgaacgggtcctggcgggcgcggaggccgcc
ggggtggacaacctcgtcgtgctcaccggcgatgtgcacgtgcactacgccttcgacatc
aagcgggacttcaccgaccccggctcgcgcaccgcgggcgtggagttcgtcaccacctcg
atcagcagcggcaagaacggcgcggacaagcccgccaactgggagacgtacctggccgcc
aacccgcacatgaagttctacaacggccgccgcggctacctgaccgtcaccctggacgag
gcgaccgcccgcggcgactaccgcacggtgtccgccgtcaccacccccggggcgccggtg
cgcaccgccgcgtccttcgtcaccgaggccggcgacccgggcctcaagcccgcctga

DBGET integrated database retrieval system