KEGG   Streptomyces sp. MOE7: STRMOE7_14900Help
Entry
STRMOE7_14900     CDS       T05374                                 

Definition
(GenBank) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00350  Tyrosine metabolism
stro00360  Phenylalanine metabolism
stro00380  Tryptophan metabolism
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    STRMOE7_14900
   00360 Phenylalanine metabolism
    STRMOE7_14900
   00380 Tryptophan metabolism
    STRMOE7_14900
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:stro04147]
    STRMOE7_14900
Enzymes [BR:stro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     STRMOE7_14900
    4.1.1.105  L-tryptophan decarboxylase
     STRMOE7_14900
Exosome [BR:stro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STRMOE7_14900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ARH91377
UniProt: A0A1W5XNE6
Position
3369546..3371024
Genome map
AA seq 492 aa AA seqDB search
MSENVGDWSPEELEKNGHLLLSQLREHFTTLRTQPVTTTRSAQEIRAVIDEPLPTAPQPF
PEILQQTWDDVRPNLTLWNHPRFHAYFSNSSSGPAILAEMFTAAMNVNVMLWDAAPAAAA
VELTVLDWLAQMVGYPVAQDSVLVDGASLGTLYALAAARERLLDLDIRQQGLAGRDLPRL
RIYTSDQTHSSVDKAAITLGVGLDNVVRLPAGPTGRLDPEALRAALERDLRSGHRPLAVV
ANVGTTSIGAIDPVEEIAEVCAAYDTWLHVDAAYGGFWRLAPEVRPLLPDLSRADSVVAN
PHKVLLSPMEAGALFCRHRDALTNTFRVVPEYLRTRHEDGSVDFMNYSLQLGRQFRALKL
WWLIKSFGVAGLTSRLSAAAALADGLRARARAHPDWTVENDSPFPLVCLRHRPHDRDLDD
AETDELNRRVHRAVNDGRTSFVSHTVLPTGYALRISIGNIHTTEADIDALWSELTAAAER
CAAPRLTERSTL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacgtcggggactggagccccgaagagctggagaagaacggccacctcctg
ttgtcccaactgcgcgagcacttcacgacgttgcgcacccagcccgtcaccaccacgcgc
tccgcgcaggagatccgcgcggtcatcgacgaaccgctgcccaccgcaccgcagccgttc
cccgagatcctgcaacagacctgggacgacgtccgccccaacctcaccctgtggaaccac
ccgcgcttccacgcgtacttcagcaacagctccagcggaccggccatcctggcggagatg
ttcaccgcggcgatgaacgtcaacgtgatgctgtgggacgccgcgccggccgccgccgcc
gtggaactgacggtcctcgactggctcgcgcagatggtcggctaccccgtggcgcaggac
tccgtactggtcgacggcgcctccctgggcacgctctacgccctggccgccgcccgggag
cggctgctggacctggacatccggcagcaggggctggccggccgggacctgccgcggctg
cggatctacacctccgaccagacccacagctccgtcgacaaggcggccatcaccctcggc
gtcggcctcgacaacgtcgtacgcctcccggccggccccaccggccggctcgaccccgag
gcgctgcgggcggccctggagcgggacctgcgcagcgggcaccggccgctggccgtggtc
gcgaacgtcggcaccacctccatcggggcgatcgacccggtcgaggagatcgccgaggtg
tgcgccgcgtacgacacctggctgcacgtcgacgcggcgtacggcggcttctggcggctg
gcgcccgaggtgcgcccgctgctgcccgacctgtcccgggccgactcggtggtggccaac
ccgcacaaggtcctgctgagcccgatggaggccggcgcgctgttctgccggcaccgcgac
gccctcaccaacaccttccgcgtcgtaccggagtacctgcgcacccgtcacgaggacggc
agcgtggacttcatgaactactcgctccagctgggcaggcagttccgggccctcaaactg
tggtggctgatcaagtcgttcggggtcgcgggcctcaccagccggctgagcgccgcggcc
gccctcgccgacggcctgcgtgcccgggcccgcgcccacccggactggacggtggagaac
gactcgcccttcccgctggtgtgcctgcgccaccgcccgcacgaccgggacctcgacgac
gcggagaccgacgagctcaaccggcgcgtccaccgggccgtcaacgacggcaggacctcc
ttcgtctcgcacaccgtgctgcccacggggtacgcgctacgcatctccatcggaaacatc
cacaccaccgaagccgacatcgacgccctgtggagcgaactcaccgccgccgcggagcgc
tgtgcggccccgcgcctgaccgaacggagcacgttatga

DBGET integrated database retrieval system