KEGG   Streptomyces sp. MOE7: STRMOE7_21145Help
Entry
STRMOE7_21145     CDS       T05374                                 

Definition
(GenBank) Geosmin synthase
  KO
K10187  germacradienol/geosmin synthase [EC:4.2.3.22 4.2.3.75 4.1.99.16]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00909  Sesquiterpenoid and triterpenoid biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    STRMOE7_21145
Enzymes [BR:stro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.16  geosmin synthase
     STRMOE7_21145
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.22  germacradienol synthase
     STRMOE7_21145
    4.2.3.75  (-)-germacrene D synthase
     STRMOE7_21145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C Herpes_env
Motif
Other DBs
NCBI-ProteinID: ARH92392
UniProt: A0A1W5XR67
Position
4752116..4754353
Genome map
AA seq 745 aa AA seqDB search
MTKPFELPDFYTPYPARLNPHLEAARTHSRKWARGMGMLEGSGIWEQRDLDAHDYALLCA
YTHPDCDAAALSLVTDWYVWVFFFDDHFLEKFKRTLDRAGGKEYLDRLPAFMPLDLGAPV
PEPTNPVEAGLADLWARTVPHMSADWRRRFAESTEHLLNESLWELSNININRVPNPVEYI
EMRRKVGGAPWSAGLVEYATGAEVPARVAGSRPLRVLRDTFSDAVHLRNDLFSYQRETEE
EGELSNGVLVLETFLDCTTQEAADAVNDLITSRLQQFENTVVAELPPLFLEKGLDPKSCA
DVLAYAKGLQDWQSGGHEWHMRSSRYMNDGGAAAGAAPPWSPFSAGGLGTSATDLKKALA
TAGAHRVRSHTHVPHQQVGPSRIPDFCMPFPLTLSPHLEGARRRVIDWADRMGLLQPQPG
VPLSDVWDEAAMARHDLALCAAGIHPDATPEQLDLDSAWLAWGTYADDYYPQVFGRTRDA
AAAYACTERLKLFMPLDPATTPPEPVNAMERALADLWPRTTRPMTPEARRAFRAAVDTMT
ASWLWEIDNQIQNRIPDPVDYIEMRRATFGSDLTMALSRLGHGRHVPPEVYRTGTLRSLE
NAAADYAALMNDVFSYQKEIEYEGEVHNGILVVQTFFDCDYPTALAIVNDLMTSRMREFQ
HVAAKELPVVYDDFQLPAEARATLDGYVRELENWMAGILNWHQGCRRYIEPELRHPVGSP
GRLGAPSGLGTSAARFFQRAAAGAG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagccattcgaactgcccgacttctacacgccgtacccggcgcggctcaacccg
cacctggaggcggcgcgtacgcactccaggaagtgggcccgcggcatggggatgctggag
ggctcgggcatctgggagcagcgggacctcgacgcccacgactacgccctgctctgcgcc
tacacccaccccgactgcgacgcggcggcgctgtcgctcgtcaccgactggtacgtctgg
gtcttcttcttcgacgaccacttcctggagaagttcaagcggacgctggaccgcgcgggc
ggcaaggagtacctcgaccggctgcccgccttcatgccgctggacctcggcgcgccggtg
cccgagccgaccaacccggtcgaggcgggactcgccgacctgtgggcccgcaccgtgccg
cacatgtcggcggactggcgccggcggttcgccgagagcaccgagcacctgctcaacgaa
tcgctgtgggaactgtccaacatcaacatcaaccgggtgcccaaccccgtcgagtacatc
gagatgcgccgcaaggtcggcggcgcgccctggtcggccgggctggtggagtacgcgacc
ggggccgaggtcccggcccgggtggccggctcccgccccctgcgggtgctgcgcgacacc
ttctccgacgccgtccacctgcgcaacgacctcttctcctaccagcgggagaccgaggag
gaaggcgagctgagcaacggagtgctggtcctggagaccttcctggactgcaccacccag
gaggccgcggacgccgtcaacgacctgatcacctcacggctccagcagttcgagaacacc
gtggtcgccgaactcccgccgctcttcctggagaagggcctcgacccgaagtcctgcgcg
gacgtcctcgcgtacgccaaggggctgcaggactggcagtccggcggccacgaatggcac
atgcgctccagccgctacatgaacgacggcggggcggcggccggcgccgcacccccctgg
tcgccgttctccgccggcggcctcggcacctcggccacggacctcaagaaggccctggcc
acggccggcgcgcaccgcgtccgcagccacacccacgtcccgcaccagcaggtcgggccc
tcgcggatccccgacttctgcatgccgttcccgctcaccctgagcccgcacctggagggc
gcccgccgccgggtcatcgactgggccgaccggatgggtctgctccagccgcagcccggc
gtgccgctctccgacgtctgggacgaggccgcgatggcccgccacgacctggcactgtgc
gcggccggcatccacccggacgccactcccgagcagctcgacctcgactccgcctggctg
gcgtggggcacctacgcggacgactactacccgcaggtcttcggccggacccgggacgcc
gccgcggcctatgcgtgcaccgaacggctgaagctcttcatgccgctcgaccccgcgacg
accccgcccgagccggtcaacgccatggaacgcgcactggccgacctctggccccgtacg
acccgcccgatgacgcccgaggcccgccgggccttccgcgcggccgtcgacacgatgacc
gccagctggctctgggagatcgacaaccagatccagaaccgcatcccggatccggtcgac
tacatcgagatgcgccgggccaccttcggctccgacctcaccatggccctcagccgcctc
ggccacggccggcacgtcccgccggaggtctaccgcaccggcaccctccgttcgctggag
aacgccgccgccgactacgccgccctgatgaacgacgtcttctcgtaccagaaggagatc
gagtacgagggcgaggtgcacaacggcatcctggtcgtccagaccttcttcgactgcgac
tacccgaccgcgctggccatcgtcaacgacctcatgacctcccgcatgcgcgagttccag
cacgtcgccgcgaaggaactcccggtcgtgtacgacgacttccagctgccggccgaggcc
cgcgccacgctcgacggctatgtgcgggagctggagaactggatggcggggatcctcaac
tggcaccagggctgccggcgctacatcgagccggagctgcgccacccggtgggctcaccg
ggccggctcggtgccccgtcggggctggggacgtcggcggcccggttcttccagcgagcg
gccgcgggcgccggatga

DBGET integrated database retrieval system