KEGG   Streptomyces sp. MOE7: STRMOE7_22400Help
Entry
STRMOE7_22400     CDS       T05374                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
stro  Streptomyces sp. MOE7
Brite
KEGG Orthology (KO) [BR:stro00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    STRMOE7_22400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: ARH92578
UniProt: A0A1W5XRR8
Position
5048876..5049874
Genome map
AA seq 332 aa AA seqDB search
MDTFALVVTIAVALGFTYTNGFHDSANAIATSVSTRALTPRAALAMAAVMNLAGAFLGSG
VAKTVSEGLIATPQGDKGMGILFAALLGAVVWNLVTWYFGLPSSSSHALFGGMVGAALAG
GTTVIWSGVVEKVVLPMFISPVVGLVLGYLVMVLILWLFRKSNPHKAKRGFRIAQTVSAA
GMALGHGLQDAQKTMGVVVMALVIADVEDPNAAIPIWVKLACALTLSLGTYAGGWRIMRT
LGRRIIELDPPQGFAAETTAASVMYTASFMFQAPISTTHVITSAIMGVGSTKRPRAVRWG
VAKNIVMGWFITMPAAALVAALAYSLIALAFG
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggacaccttcgcgctcgtcgtgaccattgcggtcgcgctcggtttcacctataccaac
ggcttccacgactccgccaacgcgatcgccacctcggtctcgacccgggcgctgaccccg
cgggccgcgctggcgatggccgccgtgatgaacctcgcgggtgccttcctcggctccggg
gtcgccaagacggtcagcgaggggctgatcgccacgccgcagggcgacaaggggatgggc
atcctcttcgcggcgctgctcggcgcggtcgtctggaacctcgtcacctggtacttcggg
ctgccctcgtcgtcctcgcacgcgctgttcggcgggatggtcggtgcggccctcgccggc
ggcacgacggtcatctggtccggggtggtcgagaaggtcgttctgccgatgttcatctcg
ccggtcgtcggcctggtgctcggctacctggtgatggtcctgatcctgtggctcttccgt
aagtcgaacccgcacaaggccaagcggggcttccgcatagcccagaccgtctcggccgcg
ggcatggccctcggccacggtctgcaggacgcccagaagaccatgggcgtggtcgtgatg
gccctggtcatcgccgacgtcgaggacccgaacgcggccatcccgatctgggtcaagctg
gcctgtgcgctcaccctctcgctgggtacgtacgcgggcggctggcgcatcatgcgcacc
ctgggccggcggatcatcgagctggacccgccgcagggcttcgccgcggagaccacggcc
gcctcggtcatgtacaccgcgtcgttcatgttccaggccccgatctccaccacccacgtc
atcacctccgcgatcatgggcgtcggctcgaccaagcgcccgcgcgcggtgcgctggggc
gtcgccaagaacatcgtgatgggctggttcatcaccatgccggcggcggcgctggtcgcg
gcgctcgcgtactcgctcatcgcgctggccttcggctga

DBGET integrated database retrieval system