KEGG   Streptomyces sp. MOE7: STRMOE7_28870Help
Entry
STRMOE7_28870     CDS       T05374                                 

Definition
(GenBank) polyprenyl diphosphate synthase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
stro  Streptomyces sp. MOE7
Pathway
stro00900  Terpenoid backbone biosynthesis
stro01100  Metabolic pathways
stro01110  Biosynthesis of secondary metabolites
stro01130  Biosynthesis of antibiotics
Module
stro_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:stro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STRMOE7_28870
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:stro01006]
    STRMOE7_28870
Enzymes [BR:stro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     STRMOE7_28870
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     STRMOE7_28870
    2.5.1.29  geranylgeranyl diphosphate synthase
     STRMOE7_28870
Prenyltransferases [BR:stro01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   STRMOE7_28870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt T2SSF V-SNARE
Motif
Other DBs
NCBI-ProteinID: ARH93638
UniProt: A0A1W5XUR9
Position
6552893..6553942
Genome map
AA seq 349 aa AA seqDB search
MTPATASQAAASQTLARCRALVQPALVEAVERLHPWLADMAAHSLGWTGTHGSFVPGSQG
KGVRQALTVLCAEAAGAPAECALAGAVTVELVHTFSLVHDDIMDGDETRRQRASTWKAYG
PGPAILAGDAMCALAAQVLCDSPAGQVGAAVRHLADALHDMARGQADDLCFEFRSWTGPD
AVRVHEYRSMAEHKTGALLGCATGLGAVLAGAPAATVAGLTRAGRHLGVAFQAVDDLLGI
WGEPEDTGKPVYSDLRRLKKTYPVLAALATDTLAAGQLMGILESGGTLDDAGARQAADLI
EEAGGRSATRREAQQHLDRAHDCLAALDLEPTACDEIQALLPSLIHRRA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctgctaccgcgtcccaggccgccgcgtcgcagaccctggcgcgctgccgcgcg
ttggtgcaaccggcgcttgtggaggccgtggagcgcctccacccgtggctggccgacatg
gcagcccactctctcgggtggaccgggacgcacggcagcttcgtccccggctcccagggc
aagggggtgcgccaggcgctcacggtgctctgcgccgaggccgccggagcgcccgcggaa
tgcgccctcgccggtgccgtcaccgtggagttggtgcacaccttctccctcgtgcacgac
gacatcatggacggcgacgagacccgtcggcagcgcgcgagcacctggaaggcatatggc
cccgggcccgcgatcctggccggtgacgcgatgtgcgccctcgccgcccaagtcctctgc
gactcccctgcgggacaggtcggagcagcggtgcggcacctggcggatgccttgcacgac
atggcgcgcggtcaggctgacgacctctgcttcgagttccgctcatggacgggcccggac
gcggtccgggtgcacgagtaccggtcgatggccgagcacaagacgggtgctctgctcggg
tgtgccaccgggctgggcgccgtgctcgccggcgcaccggccgcgaccgtcgcagggctc
acgcgggccggccggcatctcggggtggccttccaagccgttgacgacctcttgggcatc
tggggagaaccggaagacaccggcaaaccggtatacagcgatctgcgacggctgaagaag
acctacccggtgctggcggcgctggccacggacaccctggccgcagggcagctcatgggg
atactcgaatcgggcgggacactggacgacgccggcgcccgtcaggccgccgatctcatc
gaggaggcgggcgggcgctccgccacccggcgcgaagcccaacagcacctcgacagggcc
cacgactgcctggcagcgctcgacctggagccgacggcctgcgacgagatccaggcactg
ctgccttccctcatccatcgcagagcgtga

DBGET integrated database retrieval system