KEGG   Streptomyces sp. PAMC 26508: F750_1708Help
Entry
F750_1708         CDS       T02619                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
strp  Streptomyces sp. PAMC 26508
Brite
KEGG Orthology (KO) [BR:strp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    F750_1708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGJ54204
Position
1746217..1747467
Genome map
AA seq 416 aa AA seqDB search
MEHITLLLAIVVVTALVFDFTNGFHDTANAMATTISTGALKPKTAVAMSAVLNLVGAFLS
VEVAKTISGGIINENGLRTEVIFAALVGAILWNLLTWLVGLPSSSSHALFGGLIGAAVMS
AGWSSINGGTVVTKVLLPAIAAPLVAGVAALLATKLTYRLNRKITDEAQLKSTAKGYRAG
QIASAGLVSLAHGTNDAQKTMGIITLALVTGGVLAPGSNPPVWVIASAGIAIALGTYLGG
WRIIRTMGSGLTDLRPPQGFAAQTSAATVILASSHLGFSLSTTQSCSGAVMGAGLGRKGG
VVRWSTATRMFVAWGLTLPAAGLVGAGAEFLTKQGPWGVAVVAVLLVAGSGAIWLLSRRK
PVDHTNVNATGDEPAGVVTTAIAAVSPPPAGLNVPDLKTTIHAPTAETPADRPATV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaacacatcacgctgctgcttgcgattgttgtcgtaacagctctcgtgttcgatttc
acgaacggtttccacgacaccgccaacgcgatggccaccaccatctcgaccggcgccctc
aagcccaagacagcggtggccatgtccgccgttctcaacctcgtcggcgcgttcctgtcg
gtggaggtcgccaagacgatctccggcgggatcatcaacgagaacggcctcagaaccgag
gtcatcttcgccgcgctcgtcggcgcgatcctgtggaatctgctgacctggctggtcggc
ctgccctccagttcctcccacgcactcttcggcggcctcatcggcgccgcggtgatgtcg
gccggctggtcctcgatcaacggcggcaccgtcgtcacgaaggtcctgctgcccgcgatc
gccgcgcccctggtggccggagtcgccgcgctgctggccacgaagctgacgtaccgcctc
aaccggaagatcaccgacgaggcccagctcaagtccacggccaaggggtaccgcgccggc
cagatcgcctcggccggcctggtctcgctcgcccatggcaccaacgacgcgcagaagacc
atgggcatcatcaccctggccctggtcaccggcggcgtcctcgcccccggttccaacccg
ccggtctgggtcatcgcctccgccggtatcgccatcgccctgggcacctacctcggcggc
tggcgcatcatccgcaccatgggcagcggcctcaccgacctgcgtccgccgcagggcttc
gcggcccagacgagcgcggccacggtcatcctggcctcctcgcacctcggcttctccctc
tcgaccacccagtcctgctcgggtgccgtcatgggcgcgggcctcggacgcaaggggggc
gtggtccgctggtccaccgccacccggatgttcgtcgcctggggtctgacgctgccggcc
gccggcctggtcggcgcgggagccgagttcctgaccaagcagggcccctggggcgtcgcg
gtggtcgccgtcctgctcgtcgccggctccggcgccatctggctgctgtcacgccgcaag
ccggtcgaccacaccaatgtgaacgcgaccggggacgagcccgcgggcgtcgtcacgacc
gccatcgcggccgtcagcccgccgcccgccggtctgaacgtcccggacctcaagaccacc
atccacgccccgacggccgagaccccggccgaccggccggccacggtgtaa

DBGET integrated database retrieval system