KEGG   Streptomyces sp. PAMC 26508: F750_3173Help
Entry
F750_3173         CDS       T02619                                 

Definition
(GenBank) uroporphyrinogen-III methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
strp  Streptomyces sp. PAMC 26508
Pathway
strp00860  Porphyrin and chlorophyll metabolism
strp01100  Metabolic pathways
strp01110  Biosynthesis of secondary metabolites
strp01120  Microbial metabolism in diverse environments
Module
strp_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:strp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    F750_3173
Enzymes [BR:strp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     F750_3173
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     F750_3173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AGJ55645
UniProt: M9TXR9
Position
complement(3335847..3337214)
Genome map
AA seq 455 aa AA seqDB search
MVRAVTGDPGLDGNTGAEMLACAAAGVPFEVVPGIANAVGVPAYAGVPLRDAQGADVRFV
DARTASDRCWSEVGASDATAVVSTSLDSVAAAAGELVSAGRKPDTPLTVTIAGTTTRQRT
WTATLGTIAQVLKQAKVLPSPDGHLPVIAVVGERSSAAQRDQLAWFESKPLFGWKVLVPR
TKEQAASLSDQLRSYGAVPHEVPTIAVEPPRTPQQMERAVKGLVTGRYEWIAFTSVNAVK
AVREKFEEYGLDARAFAGIKVAAVGEQTGAALVDFGVKPDLMPSGEQSAAGLLEDWPPYD
PVFDPIDRVFLPRADIATETLVAGLIELGWEVDDVTAYRTVRASPPPADTREAIKGGGFD
AVLFTSSSTVRNLVGIAGKPHNVTVIACIGPATAKTAEEHGLRVDVLSPEPSVHKLAQAL
ADFGAQRRDAAKEAGDPVTRPSERRPGARRRRTTT
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcgtgccgtcacgggtgaccccggtctggacggcaacacgggcgccgagatgctc
gcctgcgctgccgcgggtgtccctttcgaggtcgtgcccggcatcgcgaacgcggtcggt
gtgcccgcgtacgccggtgtgccgctgcgtgacgcgcagggcgccgacgtgcgcttcgtc
gacgcgcgtaccgcttcggaccgctgctggtccgaggtcggcgcgagcgacgcgacggcc
gtcgtgtccacgtcgctcgactcggtcgccgcggccgcgggtgagctggtctcggccggg
cgcaagcccgacaccccgctcacggtcacgatcgccggtacgacgacccgccagcgcacc
tggacggcgaccctcgggacgatcgcccaggtcctgaagcaggcgaaggtcctcccgtcg
ccggacgggcacctgcccgtcatagccgtggtcggggagcgcagctccgcggcccagcgc
gaccagctcgcgtggttcgagtccaagccgctgttcggctggaaggtgctcgtgccgcgt
acgaaggagcaggcggcttcgctctccgaccaactgcgttcctacggtgccgtgccgcac
gaggtcccgacgatcgccgtcgagccgccgcgtacgccccagcagatggagcgggcggtc
aagggtctggtcacgggccggtacgagtggatcgcgttcacctcggtgaacgcggtgaag
gccgtgcgggagaagttcgaggagtacgggctcgacgcccgtgccttcgccgggatcaag
gtcgcggccgtcggtgagcagaccggtgcggctctggtcgacttcggtgtgaagcccgat
ctgatgccgtccggtgagcagtccgccgcgggtctgctggaggactggccgccgtacgac
ccggtcttcgacccgatcgaccgggtgttcctgccgcgcgccgacatcgccacggagacc
ctggtggccgggctcatcgagctgggctgggaggtcgacgacgtcaccgcgtaccgcacg
gtccgcgcctcgccgccgccggccgacacccgtgaggcgatcaagggcggcggtttcgac
gcggtgctcttcacctcgtcctcgaccgtccgcaacctggtcggtatcgcgggcaagccg
cacaacgtgacggtgatcgcctgcatcggtcccgccacggcgaagacggccgaggagcac
ggcctgcgggtcgacgtcctgtccccggagccgtcggtccacaagctggcccaggcgctg
gcggacttcggtgcgcagcgccgggacgcggcgaaggaggccggtgacccggtgacccgg
ccgagcgagcggcgcccgggtgcgcggcgtcgccggacgaccacctga

DBGET integrated database retrieval system