KEGG   Streptomonospora sp. M2: EKD16_06640Help
Entry
EKD16_06640       CDS       T05863                                 

Gene name
ltaA
Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00260  Glycine, serine and threonine metabolism
strr01100  Metabolic pathways
strr01110  Biosynthesis of secondary metabolites
strr01120  Microbial metabolism in diverse environments
strr01130  Biosynthesis of antibiotics
strr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EKD16_06640 (ltaA)
Enzymes [BR:strr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EKD16_06640 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP Aminotran_3 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: QBI53126
UniProt: A0A4P6PXX3
Position
1528365..1529375
Genome map
AA seq 336 aa AA seqDB search
MIDLRSDTVTRPTPAMRRAMAEAEVGDDVFGEDPTVRALEEETAALLGTEAALYVPSGHM
SNQIAVYVSTRSGDEVWTHREGHVVANEQGGTSVLARVLPRTYDSELGYPEEGLLAAWAR
GAGDVHRARPRLICLENTFTGRIVPPSEQRRVAAFAREHGMLLHLDGARMWNAAVALGET
PARIAEGADTVSVCFSKGLGAPVGSALAGGTEAIAEARRARKLLGGGMRQAGIVAAGALY
ALRNHIDRLAEDHARARRLAESIAQSPSLSAEARTNMVVVSTPAGRARDFADLLAREGIG
CVPLGENRLRLVVHLDISDTDIDTAAEAVAKTAAAG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctacgttcggacaccgttacccgtcccaccccggcgatgcggcgggccatg
gccgaggccgaggtgggcgacgacgtcttcggggaggaccccaccgtccgggcgctggag
gaggagaccgccgcactgctgggcacggaggcggcgctgtacgtgccctcgggacacatg
tccaaccagatcgccgtctacgtgtccacccgatcgggtgacgaggtctggacgcaccgc
gagggacacgtggtggccaacgagcagggcggcacctcggtgctggcgcgcgtgctgccg
cgcacctacgactccgagttgggctaccccgaggagggcctactggccgcgtgggcccgc
ggcgccggcgacgtgcaccgcgcccgaccgcgcctgatctgcttggagaacaccttcacc
gggcgcatcgtcccgccgagcgagcagcgccgcgtcgccgccttcgcccgcgagcacggc
atgctgctgcacttggacggcgcccggatgtggaacgccgccgtggcactgggggagacg
cccgcacgcatcgcggaaggggccgacacggtgtcggtgtgcttctccaaagggctgggg
gcgccggtgggctcggccctggccggcggcaccgaggcgatcgccgaggcccggcgggcg
cgcaagctgctgggcggcggcatgcgccaggccgggatcgtcgcggccggtgcgctgtat
gcgctgcgcaaccacatcgaccgcctcgccgaggaccacgcgcgggcgcggcgcctggcg
gagagtatcgcccagtcgccgtcgctctccgcggaggcgcgcaccaacatggtcgtcgtg
tccacccccgccggacgggcgcgcgacttcgccgacctgctcgctcgcgagggcatcggc
tgcgtaccgctgggggagaaccgcctgcgcctggtcgtccacctggacatctccgacacc
gacatcgacaccgccgccgaggccgtcgccaagaccgcggccgctggctga

DBGET integrated database retrieval system