KEGG   Streptomonospora sp. M2: EKD16_14170Help
Entry
EKD16_14170       CDS       T05863                                 

Definition
(GenBank) exonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
strr  Streptomonospora sp. M2
Pathway
strr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:strr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EKD16_14170
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strr03400]
    EKD16_14170
Enzymes [BR:strr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EKD16_14170
DNA repair and recombination proteins [BR:strr03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EKD16_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_4 AAA_30 UvrD_C_2 AAA_19
Motif
Other DBs
NCBI-ProteinID: QBI54615
UniProt: A0A4P6Q233
Position
3218878..3220761
Genome map
AA seq 627 aa AA seqDB search
MSGTPGSEAPSQVPPPQAAGRHPAAGDSGGGDAVGRAREALEQMGAPAGLAEPLVGALGP
RAGAEISTDPWRLLAVSGVTPQQADYCARHVLGAEASPDDPRRGKALAAHLLRQGAREGH
TALEEQRLAGALRSMGVRSVDAALSAALDGGEVLSFEMVDEPDDGDDFDGGDPGEVPDPD
RWYALTRIGLAEQDLGEGLARLAGTSEPIMDSATAAETVEATAERLGAEVDPRTAAALVT
VALRGVCVLQHGAGARVPVAHALACAAAIAADSEAGIAVASPTAQAAAEVNSALADLGAG
GDVAAVPLAVLLETRSPGVHGRRSERPIEAGLVVVTGARWLDVDRAAALVDACADGTHLV
LLADPAQAPSAAPGSVVADLVASRTVHVADLPEGPDAGPLARMAESVAGGELEEVGAPGR
EVVVVPADSAAAAAHRTVQLITDSIPRALEIPAEQVQIVAATRGGEAGTDALNAVCKERL
NPGPGAHGGLDAGDRVLVTADGPGCAAGDVGYLRVADGDDGNGQGGGAPVLAVELPGGTL
ARVADPAQLRPGWAITVAAAHGGRWPAVVAVFPPETRASRPQVYTALTTAQRHLSLVQAA
GPALAQGVRENAALPRHTRLVQVLREG
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtacgcccggatccgaggcgccgtcgcaggtgccgccaccgcaggccgccggg
cggcacccggctgcgggggattccgggggcggcgacgcggtggggcgggcgcgcgaggcg
ctggagcaaatgggcgctcccgccgggttggcggagccgctggtaggcgcgctgggcccg
cgggccggggccgaaatctccaccgacccctggcggctgctggcggtctcaggcgtgacc
ccccagcaggccgactactgcgcccggcacgtcctgggcgccgaagcttctcccgacgat
ccgcggcgcggtaaggcgctggccgcgcatctgctgcggcagggcgcgcgtgaaggccac
accgcactggaggagcagcgcctcgccggggctctgcggtcgatgggcgtccgctcggtc
gatgccgcgctgagcgcggcgctggacggcggcgaggtgctgagcttcgagatggtcgac
gaacccgacgacggcgacgacttcgacggcggcgacccgggcgaggtgcccgaccccgac
cgctggtacgcgctgacccgcatcggcctcgccgaacaggacctcggcgaggggttggcc
cgcctcgccggcaccagcgagccgatcatggactccgcgaccgccgccgagaccgtcgag
gccaccgccgagcgcctcggcgccgaggtcgacccgcggaccgccgccgcactggtcacg
gtcgcgctgcggggcgtctgcgtgctccagcacggcgcgggtgcccgggtacccgtcgcg
cacgcgctggcctgcgccgccgccatcgccgccgacagcgaggccggcatcgccgtcgcc
tcacccaccgcccaggctgccgccgaggtcaactccgccctcgccgatctgggcgccgga
ggcgacgtggccgcagtgccgctggctgtgctgctggagacccgctcccccggcgtgcac
ggccgccgctcggagcgaccgatcgaggccgggctggtagtggtcaccggcgccaggtgg
ctcgacgtggaccgggccgccgcgctcgtcgacgcctgcgccgacggcacgcacctggtt
ctgctcgccgacccggcgcaggcgccctcggccgcgccgggcagcgtcgtggccgacctg
gtcgcctcgcgcaccgtgcacgtcgccgacctgcccgaaggtcccgacgcgggtccgctg
gcacgcatggccgagtccgtggccggcggcgaactggaggaggtcggcgcaccgggccgc
gaggtggtggtcgtgcccgcggactccgccgccgctgccgcgcaccggacggtgcagctc
atcaccgactccatcccccgtgccctggagatccccgccgagcaggtgcagatcgtcgcc
gccacacgcggcggcgaggcgggcaccgacgcgctgaacgcggtgtgcaaggagcggctc
aaccccggtccgggcgctcacggcggcctggacgcgggggaccgggttctcgtgaccgcc
gacgggccgggctgcgccgccggagacgtcggctacctgcgtgtcgcagacggtgacgac
ggcaacgggcagggcggcggtgcgcctgtgctcgccgtggaactgccgggcggaactctg
gcccgggtggcggacccggcgcagctgcggccggggtgggcgatcaccgtcgccgcggcg
cacggcggccgctggcccgcggtcgtcgcggtgttcccgcccgagacgcgggcgtcgcgg
ccgcaggtctacacggcgctgacgacggcgcagcgccacctgtccctcgtgcaggccgcc
ggccccgccctggctcagggcgtgcgcgagaacgccgcgctgccccgccacacgcgcctg
gtccaggtgctgcgcgagggatga

DBGET integrated database retrieval system