KEGG   Streptomonospora sp. M2: EKD16_16835Help
Entry
EKD16_16835       CDS       T05863                                 

Gene name
bglA2
Definition
(GenBank) Beta-glucosidase A
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
strr  Streptomonospora sp. M2
Pathway
strr00460  Cyanoamino acid metabolism
strr00500  Starch and sucrose metabolism
strr01100  Metabolic pathways
strr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:strr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EKD16_16835 (bglA2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    EKD16_16835 (bglA2)
Enzymes [BR:strr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     EKD16_16835 (bglA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: QBI55136
UniProt: A0A4P6Q389
Position
complement(3911049..3912521)
Genome map
AA seq 490 aa AA seqDB search
MTQSHVSTVADPTADTNSVTDTAASPEPGVRFPEAFVWGASTASFQIEGATTADGRGPSI
WDTFSATPGKVLNGDTGDPAVDHYRRYAEDVDIMQDLGIGAYRFSIAWPRVLPEGGGAVN
QAGLDFYDRLLDRLLEAGITPWPTLYHWDLPQALEDRGGWPERDTAYRFAEFAQVLRDAF
GDRVRDWTTLNEPWCAAFLGYADGVHAPGRRDPAAALAAAHHLLLGHGLAAAVLREGDTD
RKVGLTLNQTTLRPYTTSPADVAVARRADGVRNRVFTGPLFQGRYPADMVDDLAGISDFS
FVRDGDLELVSAPLDHLGVNYYTPHWVSATAEGIDPSRVESGGDAGAFVGCDDVVFVSQG
LPRTGIGWEIDATGMYEVLVRLAAECPGVPMYVHENGAAFEDEVGPDDRVHDPDRVAYID
AHLRIVHEALKAGVPMHGYFVWSLLDNFEWAWGYSQRFGVVHVDYETQRRRVKDSGRWYS
DVVRKGGLPG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaatcacacgtgtccactgtcgccgatccgaccgccgacaccaacagcgtcacc
gacactgcggcatcccccgagcccggggtccgcttccccgaggccttcgtctggggcgcc
tccaccgcgtcgttccagatcgagggtgccaccaccgccgacgggcgcggccccagcatc
tgggacaccttctcggcgaccccgggcaaggtgctcaacggcgacaccggcgatccggcc
gtcgaccactaccggcgctacgccgaggacgtcgacatcatgcaggacctgggtatcggg
gcctaccggttctccatcgcctggccgcgggtcctccccgagggcggcggagcggtcaac
caggccgggctcgacttctacgaccggctgctggaccgactgctggaggccggcatcacg
ccctggccgacgctctaccactgggacctgccccaggccctggaggaccggggcggctgg
cccgagcgcgacaccgcctaccggttcgcggagttcgcccaggtgctgcgcgacgccttc
ggcgaccgcgtgcgcgactggacgacgctcaacgagccctggtgcgcggcgttcctcggc
tacgccgacggcgtgcacgccccgggccgccgcgaccccgcggccgcgctcgccgccgcg
caccacctgctgctgggccacggcctggccgcggcggtgctgcgcgagggagacaccgac
cgaaaggtggggctgacgctcaaccagacgacgctgcggccctacaccacctcgccggcc
gacgtggcggtggcccgccgcgccgacggggtgcgcaaccgcgtcttcaccggcccgctg
ttccaggggcgctaccccgccgacatggtcgacgacctcgccggcatcagcgacttctcc
ttcgtccgcgacggcgacctggagctggtctcggcgcccctggaccacctgggcgtcaac
tactacacgccgcactgggtttcggccaccgccgagggcatcgacccgtcgcgggtcgag
agcggcggcgacgccggcgccttcgtcggttgcgacgacgtggtgttcgtcagccagggc
ctgccgcgcaccggcatcggctgggagatcgacgccaccggtatgtacgaggtcctggtg
cggctggcggccgagtgcccgggggtgcctatgtacgtccatgagaacggtgcggccttc
gaggacgaggtcggccccgacgaccgggtgcacgaccccgaccgcgtggcctatatcgac
gcccacctgcgcatcgtgcacgaggcgctgaaggcgggcgtgccgatgcacgggtacttc
gtctggtcgctgctggacaatttcgagtgggcgtggggctattcgcagcgcttcggcgtc
gtgcacgtcgactacgagacccagcgccgccgggtgaaggacagcggccgctggtactcg
gacgtcgtgcgcaagggcggcctgcccgggtaa

DBGET integrated database retrieval system