KEGG   Streptococcus salivarius NCTC 8618: SSAL8618_02395Help
Entry
SSAL8618_02395    CDS       T03511                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
strs  Streptococcus salivarius NCTC 8618
Pathway
strs00450  Selenocompound metabolism
strs00970  Aminoacyl-tRNA biosynthesis
strs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SSAL8618_02395
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SSAL8618_02395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:strs01007]
    SSAL8618_02395
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strs03016]
    SSAL8618_02395
Enzymes [BR:strs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SSAL8618_02395
Amino acid related enzymes [BR:strs01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SSAL8618_02395
Transfer RNA biogenesis [BR:strs03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SSAL8618_02395
 Prokaryotic type
   Other AARSs
    SSAL8618_02395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AIY20623
UniProt: A0A3S4QKG8
Position
465541..467544
Genome map
AA seq 667 aa AA seqDB search
MTKTFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMNYDVFYLTGLDEHGQKIQQKA
EEAGITPQEYVDGMAVGVKDLWQLLNISYDKFIRTTDDYHEKVVAQVFERLLEKGDIYLG
EYSGWYSVSDEEFFTESQLAEVYRDEQGNVIGGVAPSGHEVELVSEESYFFKLSNYADRL
TAFFKEHPEFIQPDGRMNEMLKNFIEPGLEDLAVSRTTFTWGVKVPSDPKHVVYVWIDAL
INYITALGYGQDEHGNFDLFWQNDENHEIIHMIGKDILRFHSIYWPIILMALDLPLPTRL
VAHGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVARI
NYELANDLGNLLNRTVAMINKYFGGQVPAYVENVTDFDADLAKVVAENIEEFHKQMKAVD
FPRALDAVWNIISRTNKYIDETAPWVLAKEDGDKEQLAAVMAHLAASLRVVAHLIQPFMM
TTSNAIMEQLGLPVTFDLENLELSGFPENVTVVSKGTPIFPRLDMDEEIAYIQSQMNAGK
PQEKEWNPEEVELKSEKDQIKFDDFDKVEIRVAEVKEVEKVEGSDKLLRFRLDAGDGEDR
QILSGIAKFYPNEQELVGKKLQVVANLKPRKMMKKYVSQGMILSAEHDGKLTVLTVDPSV
PNGSVIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaacattctacatcacaacacctatctattacccatctggtaaattacatatt
ggttctgcctatacgaccattgcttgtgacgtcttagcacgttacaaacgtatgatgaac
tatgatgtcttctaccttactgggcttgatgaacacggccaaaagattcaacaaaaggct
gaagaagcaggaatcacaccacaagagtatgtggatggtatggctgttggtgttaaggac
ctctggcaacttttgaatatctcatacgataaattcatccgtacgactgatgattaccat
gaaaaagttgttgctcaagttttcgagcgtctcttggaaaaaggagatatctatcttggt
gaatactcaggttggtactcagtttcagatgaagaattcttcactgaaagtcagttggca
gaagtttaccgtgatgagcaagggaatgtcattggtggggtagctccatcaggacatgaa
gtagagttggtttctgaagaatcatatttctttaaactcagcaactacgcagaccgtttg
actgccttctttaaagaacacccagaatttatccaacctgatggtcgtatgaatgaaatg
cttaaaaacttcatcgagccaggcttggaagacttggctgtgtcacgtacaaccttcact
tggggagtaaaagtaccatcagatccaaaacacgtggtttatgtgtggattgatgctctt
atcaactatatcactgcccttggttatggtcaggatgagcatggtaactttgatttattc
tggcaaaatgatgaaaaccacgaaattatccacatgattggtaaggatatccttcgtttc
cactcaatctactggccaatcatccttatggctcttgatttgccattgcctacacgcctt
gttgcccacggttggttcgtcatgaaagacggtaagatgtctaagtctaaaggaaacgtg
atttatccagaaatgttggtagagcgttttggtctggatccactccgttactacctcatg
cgtagtcttcctgtcggttcagatggtaccttcacaccagaagactatgtggctcgtatc
aactacgaattggctaatgaccttgggaatctcctaaaccgtacagttgccatgattaac
aagtatttcggtggtcaagtgcctgcctatgttgagaacgttacagactttgatgctgat
ttggctaaggttgtggctgaaaatatcgaagagttccacaaacaaatgaaggctgtagat
ttcccacgtgccttggacgccgtttggaacatcatttcacgtaccaataagtatattgat
gaaacagctccatgggtccttgcaaaagaagatggtgacaaggaacaattggcagctgtt
atggctcacttggctgctagtcttcgtgtcgttgcccacctcattcaaccattcatgatg
accacttcaaatgccatcatggaacaacttggcttgccagtaacatttgaccttgaaaat
cttgaactttcaggcttcccagagaatgtgacagtcgtttcaaaaggaactccaatcttc
ccacgtctggacatggacgaagaaattgcctacatccaatctcaaatgaacgcaggcaaa
cctcaagagaaggaatggaacccagaagaggttgaacttaagtctgaaaaagaccaaatt
aaatttgacgactttgacaaggttgaaatccgtgtcgctgaagttaaagaagtagaaaag
gtcgaaggttcagacaaattgctccgcttccgtcttgacgctggtgacggtgaagatcgt
caaatcctctcaggtatcgctaaattctatccgaacgaacaagaattggtcggcaagaaa
cttcaagtcgtggctaatctcaaaccacgtaagatgatgaagaaatatgtcagccaaggt
atgattctttccgcagaacatgacggcaaactcactgtcttgacagtagatccatctgtt
ccaaacggaagtgtgattgggtaa

DBGET integrated database retrieval system