KEGG   Streptococcus salivarius NCTC 8618: SSAL8618_05485Help
Entry
SSAL8618_05485    CDS       T03511                                 

Gene name
truB
Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
strs  Streptococcus salivarius NCTC 8618
Brite
KEGG Orthology (KO) [BR:strs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:strs03016]
    SSAL8618_05485 (truB)
Enzymes [BR:strs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     SSAL8618_05485 (truB)
Transfer RNA biogenesis [BR:strs03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    SSAL8618_05485 (truB)
 Prokaryotic type
    SSAL8618_05485 (truB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C_2 TruB_C
Motif
Other DBs
NCBI-ProteinID: AIY21191
Position
complement(1136244..1137125)
Genome map
AA seq 293 aa AA seqDB search
MISGIINLKKEAGMTSHDAVFKLRKILQEKKIGHGGTLDPDVTGVLPIAVGKATRVIEYM
TEAGKVYEGEITIGFSTTTEDASGEVVQTTPIRELDEETVDKAMASFEGEITQIPPMYSA
VKVNGKKLYEYARAGQEVERPQRQVTITEFVRTSPIEIENGTARFTFRVACSKGTYVRTL
SVDLGAKLGYASHMSALRRTASAGLTLDEALTLSQISEMVEAGDQSFLLPIEFGVQDLPA
VQVTDDDAKEISFGRFISIDSQEPLVAAFLGDKVLAIMEKRGQVYKPRKVLSQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaggaattattaatctaaaaaaagaggctggaatgaccagtcatgatgcagta
tttaaactacgcaaaatattacaagagaaaaaaatcggacatggtggtacccttgatcca
gatgttactggtgtcctacctatagcagttggaaaagcgactcgtgtcattgaatacatg
actgaagcagggaaagtctatgagggagaaattaccattggtttttcaacaacgaccgag
gatgcaagtggtgaagtcgtccaaactactccgataagggagctagacgaagaaaccgtt
gacaaagcaatggctagtttcgagggagaaatcacacaaattcctcccatgtactcagcg
gttaaggtcaacgggaaaaaactttatgagtatgcacgcgctggacaagaagtagaacgt
ccacaacgtcaagtgacaattaccgaatttgtccgtacctcacctattgagatagaaaat
ggtactgcaagatttaccttccgtgttgcttgtagtaagggaacctatgtccgtacctta
tctgtcgacttgggggcaaaactcggctacgctagtcatatgtctgctcttcgccgaact
gcttcagcaggcctaaccttagatgaagcactaaccctctcacaaatttcagaaatggta
gaagcaggagaccaatccttcctccttcctatcgaatttggcgttcaggatctcccagct
gtacaagtcactgatgatgatgccaaagaaatctcatttggtcgcttcatttccatagac
agtcaagaacccttagtcgccgcttttttgggtgacaaagttctagctatcatggaaaaa
cgaggtcaagtttataaacctagaaaagtattaagtcaatga

DBGET integrated database retrieval system