KEGG   Streptomyces sp. SAT1: A8713_03080Help
Entry
A8713_03080       CDS       T04706                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00998  Biosynthesis of secondary metabolites - other antibiotics
strt00999  Biosynthesis of secondary metabolites - unclassified
strt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    A8713_03080
   00999 Biosynthesis of secondary metabolites - unclassified
    A8713_03080
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     A8713_03080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: ANH90252
UniProt: A0A1A9ITY4
Position
733202..734290
Genome map
AA seq 362 aa AA seqDB search
MTSVTSPATDSPTARPGRVPSFAVISGAQVRQALQGREQEITDLVEATYRLHGEGQTVNP
PSYFLRFPDRPTSRIIALPASVGGRVRVDGLKWISSFPENVAAGVPRASAVLILNDHDTG
YPFACLESSIISATRTAASAALAADRLTRTRTRPTRVGFFGTGLIARYIHTFLAGTGWSF
DTVGVYDVSADSTAGFCGYLRQATADAPGGRDARITVHDSPEELIRSSDLVVFATVAGAP
HVSDPSWFAHHPVVLHVSLRDLDPRILLEAANFVDDVEHCLKADTSPHLAEQLTGGRDFL
DGTLDDVLTGRVEPPGDRTVVFSPFGLGVLDLAVGGYVHDEVARAGNLHVVDDFFHELRR
YG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgtgacgtcccccgccaccgactcccccaccgcccggcccggccgtgtgccg
tccttcgcggtgatctccggcgcccaggtgcggcaggcgctccagggccgcgagcaggag
atcacggacctggtcgaggccacctaccggctgcacggcgaagggcagacggtcaacccg
ccgtcgtacttcctgcgcttcccggaccggcccacctcccggatcatcgcgctgcccgcc
tcggtcggcgggcgggtgcgggtggacgggctgaagtggatctccagcttcccggagaac
gtcgcggccggggtgccgcgggcgtcggcggtgctgatcctcaacgaccacgacacgggc
tatccgttcgcgtgcctggagagctccatcatcagcgccacccggacagcggcctcggcg
gcgctggccgcggaccggctcacccgcaccaggacccggcccacccgggtcggtttcttc
ggcacgggactgatcgcccggtacatccacacgtttctcgccggcaccggctggagcttc
gacacggtcggcgtgtacgacgtgtcggccgacagcacggcgggcttctgcggctatctg
cgccaggccacggccgacgcgccgggcgggcgggacgcgcggatcaccgtgcacgacagc
ccggaggagctgatccgctccagcgacctggtggtcttcgcgaccgtggcgggcgcaccg
catgtcagcgacccgtcctggttcgcccaccatccggtggtcctgcatgtgtcgctgcgc
gacctggacccccggatcctgctggaggcggccaacttcgtcgacgacgtcgagcactgc
ctgaaggcggacacctcgccgcatctggccgaacagctcaccggtgggcgggacttcctg
gacggcacgctcgacgacgtgctgaccggccgggtggagccgccgggcgaccggaccgtg
gtcttctccccgttcggtctcggtgtcctcgacctcgccgtcggcggttacgtccacgac
gaggtggctcgggccgggaatctccatgtcgtcgacgacttcttccacgagctgcgccgg
tacggctga

DBGET integrated database retrieval system