KEGG   Streptomyces sp. SAT1: A8713_04615Help
Entry
A8713_04615       CDS       T04706                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00051  Fructose and mannose metabolism
strt00520  Amino sugar and nucleotide sugar metabolism
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A8713_04615
   00520 Amino sugar and nucleotide sugar metabolism
    A8713_04615
Enzymes [BR:strt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     A8713_04615
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     A8713_04615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_II PGM_PMM_I NTP_transf_3 Hexapep PGM_PMM_III IspD DUF4954
Motif
Other DBs
NCBI-ProteinID: ANH90524
UniProt: A0A1A9IVD8
Position
complement(1065097..1067592)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSSMPKPLLPVANRPIMEHVLRLLKRHGLNETVVTVQFLASLV
KNYFGDGEELGMELTYANEEKPLGTAGSVKNAEEALKDDAFLVISGDALTDFDLTDLIRF
HKEKGAMVTVCLTRVPNPLEFGITIVDEEGQVERFLEKPTWGQVFSDTVNTGIYVMEPEV
FNYVEADVPVDWSGDVFPQLMKEGKPIYGYIAEGYWEDVGTHESYVKAQADVLEGKVDVD
IDGFEISPGVWVAEGAEVHPDAELRGPLYIGDYAKVEAGAEIREHTVVGSNVVVKSGAFL
HKAVVHDNVYIGQHSNLRGCVVGKNTDIMRAARIEDGAVIGDECLIGEESIVQGNVRVYP
FKTIEAGAFVNTSVIWESRGQAHLFGARGVSGILNVEITPELAVRLAGAYATTLKKGSTV
TTARDHSRGARALKRAVISALQASAIDVRDLENVPLPVARQQTARGSAGGIMIRTSPGVP
DSVDIMFFDGQGADLSQGSQRKLDRVFARQEYRRAFPGEIGDLYFPSSVFDSYTGSLLRN
VDTTGIAEAGLKVVVDASNGSAGLVLPSLLGKLGVDSLTINPGLDESRPTETEEMRRAGL
VRLGEIVASSGAAFGVRFDPVGERLSLVDEKGRIIEDDRALLVMLDLVAAERRSGRVALP
VTTTRIAEQVAAYHGTQVEWTTTSPDDLTRVGGEEGTIFGGDGKGGFIVPEFSSVYDGTA
AFVRLIGLVARTQLTLSQIDARIPRAHVLKRDLATPWAVKGLVMRRVVEAAGERFVDTTD
GVRVVETDGRWVMVLPDPAEAVTHLWAEGPDDASAQALLDEWSAVVDSAGR
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtgatggccggaggcgaaggcacacgccttcgcccgatgacctcgagc
atgcccaagccgctcctgccggtggccaaccggccgatcatggagcacgttctgcggctg
ctcaaaaggcatgggctgaatgagaccgtcgtcacagtccagttcctggcttcgctggtc
aagaactatttcggtgatggtgaagagctcggcatggagctcacctatgccaatgaggag
aagccactcggtaccgcgggaagcgtcaagaacgccgaggaggcgttgaaggacgacgcc
ttcctcgtcatctccggcgacgcgctgaccgacttcgacctcaccgacctgatccggttc
cacaaggaaaagggcgcgatggtgaccgtgtgtcttacacgcgttcccaaccccctggaa
ttcggcatcaccatcgtcgacgaagagggccaggtcgagcgcttcctggagaagccgacc
tggggtcaggtcttctccgacaccgtgaacacgggcatctatgtgatggagcccgaggtc
ttcaactacgtggaggccgatgtccccgtcgactggtccggcgatgtcttcccgcagctg
atgaaggaaggcaagcccatctacggctatatcgccgagggctactgggaggacgtgggc
acccacgagagctacgtgaaggcccaggccgatgtcctcgaaggcaaggtggacgtcgac
atcgacggcttcgagatctcgccgggcgtctgggtcgcggaaggcgccgaggtgcatccc
gacgccgagctgcgcggtccgctgtacatcggtgactacgccaaggtggaggccggcgcg
gagatccgcgagcacaccgtcgtcgggtcgaacgtcgtcgtcaagagcggtgccttcctg
cacaaggccgtcgtgcacgacaacgtgtacatagggcagcacagcaacctgcgcggctgt
gtcgtgggcaagaacaccgacatcatgcgggccgcgcgcatcgaggacggcgcggtcatc
ggcgacgagtgcctgatcggcgaagaatcgatcgtgcagggcaatgtgcgggtgtacccg
ttcaagaccatcgaggcgggcgccttcgtcaacacctcggtcatctgggagtcgcggggc
caggcgcacctcttcggcgcccgtggcgtctccggcatcctgaatgtggagatcaccccg
gaactcgccgtacggctcgcgggagcgtatgcgacgaccctgaagaagggctccacggtc
accaccgcccgcgaccactcccgcggtgcgcgtgccctgaagcgggccgtcatctccgcg
ctccaggccagcgccatcgacgtacgggacctggagaacgtaccgctgcccgtcgcccgg
cagcagaccgcgcgcggcagcgccggcggcatcatgatccgtacgtcgcccggggtgccg
gactcggtcgacatcatgttcttcgacgggcagggcgccgacctgtcgcagggcagccag
cggaagctggaccgggtcttcgcgcggcaggagtaccggcgggcgttccccggcgagatc
ggcgacctgtacttcccctccagcgtcttcgactcgtacaccggttcactgctgcgcaac
gtggacacgaccgggatcgccgaggcgggcctcaaggtggtcgtggacgcctccaacggc
agtgccggcctggtcctgccgagcctgctcggcaagctcggggtggactcgctgaccatc
aaccccggcctggacgagtcccggccgacggagaccgaggagatgcgccgggccggcctg
gtgcggctcggcgagatcgtggcgtcctccggggccgcgttcggcgtgcggttcgacccg
gtgggcgagcggctgtcgctcgtcgacgagaagggccggatcatcgaggacgaccgggcg
ctgctggtcatgctggacctcgtcgccgccgagcggcgcagcggccgggtggcgctgccg
gtcaccacgacccgtatcgccgagcaggtcgccgcgtaccacgggacgcaggtggagtgg
acgaccacgtcgccggacgacctcacccgggtcggcggcgaggaggggacgatcttcggc
ggtgacggcaagggcggattcatcgtcccggagttcagcagcgtctatgacggcacggcc
gctttcgtacggctcatcggtctggtggcgcgcacgcagctgaccctcagccagatcgac
gcgcggatcccgcgggcccatgtcctcaagcgggatctggccacgccgtgggccgtcaag
ggcctggtcatgcgccgcgtcgtcgaggcggccggggagcgcttcgtggacacgacggac
ggggtgcgggtcgtggagaccgacggccgctgggtgatggtgctgcccgacccggccgag
gcggtcacccatctgtgggccgagggtcccgacgacgcctccgcgcaggccctgctcgac
gagtggtcggcggtcgtcgacagcgccggacggtag

DBGET integrated database retrieval system