KEGG   Streptomyces sp. SAT1: A8713_06970Help
Entry
A8713_06970       CDS       T04706                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00053  Ascorbate and aldarate metabolism
strt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    A8713_06970
Enzymes [BR:strt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     A8713_06970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 Polysacc_synt_2 adh_short RmlD_sub_bind NmrA KR
Motif
Other DBs
NCBI-ProteinID: ANH90937
UniProt: A0A1A9ITI4
Position
1593494..1594303
Genome map
AA seq 269 aa AA seqDB search
MPAPRTVLLTGAAGGLGTLMRDLLPRYGYTLRLFDMRPVEGAPDAVTADLADRAALREAV
RGVDAIIHLAGISLEAPFEKILRANIEGTYHLYEAAREEGVGRIVFASSNHAVGHTPVPR
EGDPLIPVDTPRRPDTFYGLSKSFGEDLAQLYWDRHGLETVSVRIGSCFPEPTSVRMLSI
WLSPADGARLFHAALTAEHVGHTVVYGSSANTRLWWDLSGARALGYAPRDDSEPYAAKLV
AEQGGLDPDEPAHARLGGHFVTDPPIWPY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctccccgcaccgttctgctcaccggcgccgccggcgggctcggcaccctgatg
cgggacctgctgccgcggtacggctacacgctgcgtctgttcgacatgcggccggtcgag
ggcgccccggacgccgtcaccgctgacctcgccgaccgggcggccctgcgcgaggcggtc
cggggcgtcgacgcgatcatccacctggcgggcatctccctggaagccccgttcgagaag
atcctcagggccaacatcgaggggacgtaccacctctacgaggccgcgcgcgaggagggc
gtcgggcggatcgtcttcgcctcctccaaccacgcggtcggtcacacgcccgtgccgcgc
gagggcgatccgctgatcccggtcgacacgccgcgccgccccgacaccttctacggcctg
tccaagtcgttcggcgaggacctcgcccagctctactgggaccggcacggcctggagacc
gtctcggtgcgcatcggctcctgcttccccgagccgaccagtgtgcgcatgctctcgatc
tggctgagccccgccgacggcgcccgcctcttccacgccgccctcaccgccgagcacgtg
ggccacaccgtcgtctacggctcctccgccaacacccgcctgtggtgggacctgtcgggc
gcgcgggcgctcggctacgcgccccgggacgactcggagccgtacgccgcgaagctcgtc
gcagagcagggcgggctcgacccggacgagccggcccacgcccgcctcggcggccacttc
gtcaccgacccgccgatctggccgtactga

DBGET integrated database retrieval system