KEGG   Streptomyces sp. SAT1: A8713_08340Help
Entry
A8713_08340       CDS       T04706                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00020  Citrate cycle (TCA cycle)
strt00310  Lysine degradation
strt00380  Tryptophan metabolism
strt01100  Metabolic pathways
strt01110  Biosynthesis of secondary metabolites
strt01120  Microbial metabolism in diverse environments
strt01130  Biosynthesis of antibiotics
strt01200  Carbon metabolism
Module
strt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
strt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8713_08340
  09105 Amino acid metabolism
   00310 Lysine degradation
    A8713_08340
   00380 Tryptophan metabolism
    A8713_08340
Enzymes [BR:strt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     A8713_08340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANH91186
UniProt: A0A1A9IUJ1
Position
1918340..1920124
Genome map
AA seq 594 aa AA seqDB search
MAVSVTLPALGESVTEGTVTRWLKAEGERVEADEPLLEVSTDKVDTEIPSPAAGVLASIK
VAEDETVEVGAELAVIDDGSGAPAAAEAPAAEAEPAPAAEPAPAPVAEAPAAEAPAPAAQ
APAAPAGGAEGTDVVLPALGESVTEGTVTRWLKSVGDSVEADEPLLEVSTDKVDTEIPAP
TSGVLLEIVVGEDETAEVGAKLAVIGAPGAAPAAAPAPAAPAPAPAAPAPAPEPAAPQAP
AAPAAPAPAPQAPAAPAPAPQAPAAPAPAPAPAPAAAPAAPAPAAQATDDGAYVTPLVRK
LAAENGVDLGAVKGTGVGGRIRKQDVLSAAEAAKTPAAAAAAPAAKKAPALEASPLRGQT
VKMPRIRKVIGDNMVKALHEQAQLSSVVEVDVTRLMRLRAQAKDSFAAREGVKLSPMPFF
VKAAAQALKAHPAINAKINEAEGTITYFDTENVGIAVDSEKGLMTPVIKHAGDLNIAGIA
KATAELAGKVRASKITPDELSGATFTISNTGSRGALFDTIIVPPGQVAILGIGATVKRPA
VIETEEGTVIGVRDMTYLTLSYDHRLVDGADAARYLTAVKAILEAGEFEVELGL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttccgtaaccctgccggcgctcggcgagagcgtcaccgagggcactgtcacc
cgctggctgaaggccgagggcgagcgcgtcgaggccgacgagccgctgctcgaggtctcg
accgacaaggtcgacaccgagatcccctcgccggccgccggtgtgctggcctccatcaag
gtcgccgaggacgagacggtggaggtcggcgccgagctggccgtcatcgacgacggctcg
ggcgcccccgccgctgccgaggcgcccgccgccgaggccgagcccgccccggccgccgag
cccgccccggcccccgtcgccgaggcccccgccgccgaggccccggctcctgccgctcag
gcgcccgccgcccccgccggtggcgccgagggcacggacgtggtcctgcccgcgctcggt
gagtccgtcaccgagggcaccgtcacccgctggctgaagtcggtcggcgactccgtcgag
gccgacgagccgctgctggaggtctccacggacaaggtcgacaccgagatcccggcgccc
acctccggcgtgctcctggagatcgtggtcggcgaggacgagaccgccgaggtcggcgcc
aagctcgccgtcatcggtgccccgggtgccgctcccgcggccgccccggctccggccgcc
cccgccccggcccccgcggccccggccccggctccggaaccggccgccccgcaggctccg
gccgcccccgcggcccccgccccggccccgcaggctcccgccgctccggccccggccccg
caggccccggccgccccggctccggcgcccgccccggccccggccgccgctccggccgcc
cccgccccggccgcccaggcgaccgacgacggtgcctacgtgaccccgctggtgcgcaag
ctcgccgccgagaacggcgtcgacctgggcgccgtcaagggcaccggcgtcggcggacgc
atccgcaagcaggacgtgctctccgcggccgaggccgcgaagaccccggccgccgccgct
gccgcgcccgccgcgaagaaggcccccgccctggaggcctccccgctgcgcggccagacc
gtgaagatgccgcggatccgcaaggtcatcggcgacaacatggtcaaggccctgcacgag
caggcgcagctgtcctcggtggtcgaggtcgacgtgacccggctgatgcggctgcgcgcg
caggcgaaggactccttcgcggcgcgcgagggcgtcaagctctccccgatgccgttcttc
gtcaaggccgccgcgcaggcgctgaaggcccacccggccatcaacgccaagatcaacgag
gccgaggggaccatcacctacttcgacaccgagaacgtcggtatcgcggtggactccgag
aagggcctgatgaccccggtcatcaagcacgccggtgacctcaacatcgccggtatcgcc
aaggccacggccgagctggcgggcaaggtgcgggccagcaagatcacgccggacgagctg
tccggtgcgaccttcaccatctccaacaccggttcgcgcggcgcgctcttcgacacgatc
atcgtgccgccgggccaggtcgcgatcctcggcatcggtgccacggtcaagcgtccggcc
gtcatcgagaccgaggagggcacggtcatcggcgtccgcgacatgacctacctgaccctc
tcctacgaccaccgcctggtggacggcgccgacgcggcccgttacctgacggcggtcaag
gcgatcctggaggcgggcgagttcgaggtcgagctgggtctctga

DBGET integrated database retrieval system