KEGG   Streptomyces sp. SAT1: A8713_11860Help
Entry
A8713_11860       CDS       T04706                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
strt  Streptomyces sp. SAT1
Pathway
strt00511  Other glycan degradation
strt00520  Amino sugar and nucleotide sugar metabolism
strt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:strt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A8713_11860
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8713_11860
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:strt03110]
    A8713_11860
Enzymes [BR:strt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     A8713_11860
Chaperones and folding catalysts [BR:strt03110]
 Intramolecular chaperones
  Others
   A8713_11860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ANH95397
UniProt: A0A1A9J8D0
Position
complement(2730653..2732296)
Genome map
AA seq 547 aa AA seqDB search
MDVIPQPGRATADEERFLELGPDTTVSAGEGTGRTERWLRTALGAATGLPLAPAPAGDDG
TLRLRLDDTVARDLGPEGYRLTVTPRGADLAGGGPAGLFWGAQTLRQLLGPAAFRRAPLP
GGRWRLPLTEIEDTPRFRWRGVMLDVARHFMPKDGVLRYLDLMAAHKLNVLHFHLTDDQG
WRVEIKRYPKLTGTGSWRPRTKYGHRASPLWEDKPHGGHYTQDDIREIVAYAAERHITVV
PEVDVPGHSQAAIAAYPELGNTDVVDTAALGVWDDWGVSKNVLAPTDATVRFYEGVFEEL
LDLFPPDAAPFSDFFHIGGDECPKEQWRASATAQARIKELGLADEDELQSWFIRHFDTWL
AARGRRLIGWDEILEGGLAEGAAVASWRGYAGGLAAARAGHDVVMCPEQHVYLDHRQDGG
ADEPVPIGFVRTLEDVYRFEPVPAGLEPEFTGHVLGTQANLWSEVMENPARVDYQAFPRL
AAFAEVAWSALPAPEQRDFAGFEERMTAHYRRLDALGVGYRPPAGPHPWQRRPGVLGRPI
DGPPPVR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgatcccccagccagggcgtgcgacggccgacgaggaacgcttcctcgaactg
ggcccggacaccacggtgtcggcgggcgagggcaccgggcgcaccgaacgctggctgcgc
accgccctcggtgccgccaccggactgccgctggcccccgccccggccggcgacgacggc
accctgcgcctgcgcctggacgacaccgtcgcccgcgacctcgggcccgagggctaccgc
ctgacggtcaccccgcggggcgccgacctcgcgggcggcggccccgccgggctcttctgg
ggcgcccagacgctgcgccagctcctcggcccggccgccttccggcgcgcgccgctgccc
ggtggccgctggcggctgccgctcaccgagatcgaggacaccccgcgcttccgctggcgc
ggcgtgatgctggacgtcgcccggcacttcatgcccaaggacggcgtcctgcgctacctc
gacctgatggccgcccacaaactcaacgtcctccacttccacctgacggacgaccagggc
tggcgcgtcgagatcaagcgctacccgaagctgaccgggaccggctcctggcgcccccgc
acgaagtacggccaccgggcctccccgctgtgggaggacaagccgcacggcggccactac
acccaggacgacatccgggagatcgtcgcctacgccgccgaacggcacatcaccgtcgtc
cccgaggtggacgtaccggggcactcccaggccgccatcgccgcctacccggaactcggc
aacaccgacgtggtcgacaccgccgccctcggcgtctgggacgactggggcgtcagcaag
aacgtgctcgccccgaccgacgccaccgtgcgtttctacgagggcgtcttcgaggaactg
ctcgacctcttcccgccggacgccgcgccgttctcggacttcttccacatcggcggcgac
gagtgccccaaggagcagtggcgcgcctcggccaccgcgcaggcccggatcaaggagctc
ggcctggccgacgaggacgagctgcagtcctggttcatccgccacttcgacacctggctc
gccgcgcgcggacgccggctcatcggctgggacgagatcctggagggcggcctcgccgag
ggcgcggccgtcgcgtcctggcgcggctacgcgggcggactcgccgccgcgcgcgcggga
cacgacgtcgtcatgtgtcccgagcagcatgtgtacctggaccaccgacaggacggcggc
gccgacgaacccgtaccgatcggcttcgtccgcaccctggaggacgtctaccggttcgag
ccggttccggccggtctggaaccggagttcaccggccatgtgctgggcacccaggccaac
ctgtggagcgaggtgatggagaaccccgcgcgcgtggactaccaggccttcccccggctg
gccgccttcgcggaggtcgcctggagcgccctgcccgcgcccgagcagcgggacttcgcc
ggtttcgaggagcggatgacggcccactaccggcgtctggacgcgctgggggtcggctac
cggccgcccgccggaccgcatccctggcagcgcaggcccggcgtcctggggcggccgatc
gacggcccgccgccggtcaggtag

DBGET integrated database retrieval system