KEGG   Streptomyces sp. SAT1: A8713_19875Help
Entry
A8713_19875       CDS       T04706                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
strt  Streptomyces sp. SAT1
Brite
KEGG Orthology (KO) [BR:strt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8713_19875
Enzymes [BR:strt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     A8713_19875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: ANH93146
UniProt: A0A1A9J2W4
Position
4576069..4576920
Genome map
AA seq 283 aa AA seqDB search
MAVHAHPDDESSKGAATMAKYVSEGVDVLVVTCTGGERGSILNPKLQGDAYIEENIHEVR
KKEMDEAREILGVAQDWLGFVDSGLPEGDPLPPLPEGCFALEDVDRAAGELVRRIRSFRP
QVITTYDENGGYPHPDHIMTHKITMVAFEGAADTGKYPEEEYGPAYRPVKLYYNQGFNRA
RTEALHKALLDRGLESPYGEWLERWEKSGHKDRTLTTHVPCADFFEIRDKALIAHATQID
PDGGWFRVPMDVQKEVWPTEEYELAKSLVDTSLPEDDLFAGVR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcacgcgcaccccgacgacgagtcgagcaagggcgcggccaccatggcgaag
tacgtgtccgagggggtggacgtgctggtggtgacctgcacgggcggagagcgcggctcc
atcctcaacccgaagctccagggcgacgcgtacatcgaggagaacatccacgaagtgcgc
aagaaggagatggacgaggcccgggagatcctcggcgtcgcgcaggactggctcggcttc
gtcgactcgggcctgcccgagggcgacccgctgccgccgctgcccgagggctgcttcgcc
ctggaggacgtcgacagggcggccggtgagctggtgcgccgcatccgctccttccgcccg
caggtgatcaccacctacgacgagaacggcggctacccgcaccccgaccacatcatgacc
cacaagatcacgatggtggcgttcgagggcgcggcggacacgggcaagtacccggaggag
gagtacggcccggcgtaccggccggtgaagctgtactacaaccagggcttcaaccgcgcc
cgcaccgaggccctgcacaaggcgctgctcgaccggggcctggagtcgccctacggcgag
tggctggagcgctgggagaagtccggccacaaggaccgcaccctgaccacgcacgtgccc
tgcgcggacttcttcgagatccgcgacaaggcgctgatcgcgcacgccacgcagatcgat
ccggacggcggctggttccgggtgccgatggacgtccagaaggaggtctggccgaccgag
gagtacgagctggcgaagtcgctcgtggacacctccctccccgaggacgacctctttgcg
ggtgtccggtag

DBGET integrated database retrieval system