KEGG   Streptomyces sp. SAT1: A8713_20750Help
Entry
A8713_20750       CDS       T04706                                 

Definition
(GenBank) phosphatase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
strt  Streptomyces sp. SAT1
Brite
KEGG Orthology (KO) [BR:strt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8713_20750
Enzymes [BR:strt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     A8713_20750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Glyco_hydro_114
Motif
Other DBs
NCBI-ProteinID: ANH93289
UniProt: A0A1A9J0D4
Position
4779831..4780709
Genome map
AA seq 292 aa AA seqDB search
MRIDLHTHSDASDGTDTPAELVRNAAAAGLDVVALTDHDTTRGHAEAIAALPEGLTLVTG
AELSCRVDGVSMHMLAYLFDPEEPALLAERELVRDDRVPRAQGMVARLNALGVPVTWEQV
ARIAGDGSVGRPHVASALVELGVVPTVSDAFTDQWLADGGRAWVAKHETDPFEAIRLVKG
AGGVCVFAHPAAAKRGRTVPESTIAELAAAGLDGIEVDHMDHDAPTRARLRGLAGELGLL
VTGSSDYHGDRKAVALGEFTTHPDVYGEITRRATGAFPVPGAGGDGAVAGTA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtatcgacctgcacacccactccgacgcgtccgacggcacggacaccccggccgaa
ctggtgcggaacgccgccgcggccggactggacgtcgtcgcgctgaccgaccacgacacc
acccgcggccacgccgaggcgatcgccgcgctgcccgaggggctgaccctcgtcaccggc
gccgagctgtcgtgccgcgtcgacggcgtcagcatgcacatgctggcctacctcttcgac
cccgaggagcccgccctgctcgccgagcgggagctggtccgcgacgaccgggtgccccgg
gcccagggcatggtcgcccggctcaacgcgctcggtgtgcccgtcacctgggaacaggtc
gcgcggatcgcgggcgacggctcggtcggccgcccgcacgtcgcctccgccctcgtggag
ctgggcgtcgtaccgaccgtgagcgacgccttcaccgaccagtggctggccgacggcggc
cgggcctgggtcgccaagcacgagaccgacccgttcgaggcgatccgcctggtcaagggc
gcgggcggggtctgcgtcttcgcacacccggccgccgccaagcgcgggcgtacggtcccg
gagtccacgatcgccgagctggccgccgccggtctcgacggcatcgaggtcgaccacatg
gaccacgacgcgccgacccgggcccggctgcgcggcctggccggggagctgggcctgctg
gtcaccggctccagcgactaccacggcgaccgcaaggccgtcgccctgggcgagttcacc
acgcaccccgacgtgtacggggagatcacgcggcgggcgaccggagcgttcccggtgccg
ggcgccggcggagacggcgcggtcgcgggcacggcctga

DBGET integrated database retrieval system