KEGG   Streptomyces qaidamensis: A4E84_04355Help
Entry
A4E84_04355       CDS       T04777                                 

Definition
(GenBank) hypothetical protein
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00998  Biosynthesis of secondary metabolites - other antibiotics
stsi00999  Biosynthesis of secondary metabolites - unclassified
stsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    A4E84_04355
   00999 Biosynthesis of secondary metabolites - unclassified
    A4E84_04355
Enzymes [BR:stsi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     A4E84_04355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AMW08799
UniProt: A0A143BVC7
Position
complement(1051807..1052847)
Genome map
AA seq 346 aa AA seqDB search
MLQLTDGDVEKLIETVDVVDAVREVFLARAAQRAVLPEESCLRWTNDHGESCRSLNMPGL
VEIGGRRFAGTKIINASLGNPDRGLARADGLVLLFDLTTARPVCLMPAARVSAARTAAVS
VLATELSWAHPTRSVAVVGAGALADAHLGLALRRWPSLRTVRLHDRVPERAALLAERLGS
AHPEVAFDVTGTAEEAVRGAELVIPATTTTTGYIPAEWIAEGAVVVNVSLDDLLPDVFTS
ADKVIVDDWSLVAADTTRLLGRMYRAGDVLPPPRARAADAAGPHGVEVAAELCDIISGTA
SPRTSAADRVVINPFGMSLHDVAVAGRIHTAHLGTTPSPLAGAAVT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcagctcaccgatggtgacgtggagaagctcatcgagacggtcgatgtcgtggat
gccgtacgtgaggtgtttctcgcccgcgcggcacagcgcgcggtgctcccggaggagagc
tgcctgcggtggaccaacgaccatggtgagtcctgtcgcagtctcaacatgcccggtctc
gtcgagatcggcggcagacgattcgccggcacgaagatcatcaacgcgagcctgggcaac
ccggaccgcggactggcgcgtgccgacggcctcgtcctcctcttcgacctcaccaccgcc
cggccggtctgcctcatgccggcggcccgcgtgtcggccgcccgtaccgcggcggtgagc
gtgctcgcgaccgagctcagctgggcccaccccacccgctccgtcgcggtcgtgggcgcc
ggagcgctcgccgacgcccatctcgggctggcgctgcgccgatggccgtccctgcggacc
gtacggctccacgaccgggtccccgagcgggcggcgctcctcgccgaacgcctgggatcc
gcccaccccgaggtcgccttcgacgtcaccggtacggccgaggaggccgtacgcggggcg
gagctggtcatcccggccacgacgacgaccaccgggtacatccccgcggaatggatcgcg
gagggagccgtcgtcgtcaacgtgtccctggacgacctgctgcccgatgtgttcacgagc
gccgacaaggtgatcgtggacgactggagcctcgtcgccgccgacaccacacggctgctc
ggcaggatgtaccgcgccggcgacgtcctgccgccgccgcgcgcacgtgccgctgacgcc
gccgggccccacggtgtggaggtcgccgccgaactctgcgacatcatcagcggcaccgcc
tcgccccgcacgtccgccgccgaccgcgtcgtgatcaacccgttcgggatgtcactgcac
gacgtggcggtcgcgggccggatccacacagcacacctcggcacgacgccgtctcccctc
gcgggagccgccgtgacgtga

DBGET integrated database retrieval system