KEGG   Streptomyces qaidamensis: A4E84_09305Help
Entry
A4E84_09305       CDS       T04777                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00051  Fructose and mannose metabolism
stsi01100  Metabolic pathways
stsi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    A4E84_09305
Enzymes [BR:stsi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     A4E84_09305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AMW09677
UniProt: A0A143BWS5
Position
complement(2127252..2128004)
Genome map
AA seq 250 aa AA seqDB search
MAEQRGDERGTGDAREGGRDAGEGGRGAGEPRRRSARPEEAHAWEELVAAARRTVADGLV
VGTSGNVSVRVGDTVLVTPSGVPYDRLTPDDVTGVGLDGRQVLGTLVPTSELPMHLAVYR
TTGARAVVHTHAVHATAVSTLVSELPLIHYMAAALGGPVRVAPYATYGTDELAENMLRAL
DGRSGCLLQNHGTVTHGTTLAQAYDRTAQLEWMCRLWLTASSVPGQAPSLLSREQLTEVE
ERLRGYGQRG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcagcgaggcgacgagcggggcacgggggacgcgcgggagggcggacgggac
gcgggggagggcggacggggcgcgggggagccgcggcgcaggagcgcgcgccccgaggag
gcgcacgcctgggaggagctcgtcgcggcggcccgccggacggtcgcggacggactggtc
gtcggcacgtcgggcaacgtctccgtgcgcgtcggggacaccgtcctggtcacaccgtcg
ggcgtcccctacgaccggctgaccccggacgacgtgaccggcgtcggcctcgacggccgg
caggtcctcggcaccctcgtccccaccagcgagctgcccatgcacctcgcggtctaccgc
accaccggcgcccgggccgtcgtccacacccacgccgtccacgcgacggccgtctcgacg
ctcgtgagcgaactcccgctgatccactacatggccgcggcactcggcggccccgtccga
gtcgccccgtatgccacgtacggcaccgacgagctggccgagaacatgctccgcgccctc
gacggccgctccggctgcctcctccagaaccacggcaccgtcacccacggcaccaccctc
gcccaggcctacgaccgcaccgcccagctggagtggatgtgccgcctgtggctgaccgcc
tcctcggtgcccggccaggccccgagcctgctgtcccgggaacagctgacggaggtggag
gagcgcctgcgcggctacggccagcggggctga

DBGET integrated database retrieval system