KEGG   Streptomyces qaidamensis: A4E84_09310Help
Entry
A4E84_09310       CDS       T04777                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
stsi  Streptomyces qaidamensis
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A4E84_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2070
Motif
Other DBs
NCBI-ProteinID: AMW09678
UniProt: A0A143BWQ1
Position
2128359..2129603
Genome map
AA seq 414 aa AA seqDB search
MESFSLILAIVVVTALAFDFTNGFHDTANAMATTISTGAMKPKVAVAMSAVLNLVGAFLS
VEVANTISKGLVDEAGIRPEVIFAALVGAILWNLLTWLVGLPSSSSHALMGGLIGATIAS
AGVGAVHGDVLLTKVLIPAIAAPLVAGIAAMLATRLTYSLGKKADGEASRKGYRAGQIAS
AGLVSLAHGTNDAQKTMGIITLALVAGGTLAPDSDPPMWVILSAGVAIALGTYLGGWRII
RTMGKGLTDLQPQQGFAAQTSAATVILASSHLGFSLSTTHSVSGAVMGAGLGRKGGVVRW
STATRMFVAWGLTLPAAALVGALAEYVTGFGAWGTAVVAVFLVSSSAAIWKLSRREIVDH
TNVNDTDDAEPAGVVTTAMAAVTPPPAGTPAEEPVPSFPAQATAERTASTTTTV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcttctcgctgatcctcgcgattgtggtggtaaccgcactcgcgttcgatttc
acgaacggtttccacgacaccgcgaacgcgatggccacaaccatttccacgggcgccatg
aagcccaaggttgcggtggccatgtccgcggtcctcaacctggtcggcgccttcctgtcc
gtcgaagtcgccaacacgatctccaagggcctcgtcgacgaggccggcatccggcccgag
gtcatcttcgccgccctggtcggtgcgatcctctggaacctgctgacgtggctggtcggt
ctgccgtccagctcctcgcacgctctcatgggcggtctgatcggtgccacgatcgcctcg
gcgggcgtcggcgcggtgcacggtgacgtgctgctcaccaaggtcctgatcccggcgatc
gccgccccgctggtcgcgggcatcgcggcgatgctggccacacggctgacgtactccctc
ggcaagaaggccgacggcgaggcgtcccggaagggctaccgggccggtcagatcgcgtcg
gcgggcttggtctccctggcgcacggcaccaacgacgcgcagaagacgatgggcatcatc
accctcgccctggtcgccggcggcaccctcgcccccgactccgacccgcccatgtgggtc
atcctctccgcgggcgtcgcgatcgcgctcggcacgtacctgggcggctggcgcatcatc
cgcaccatgggcaagggcctgaccgacctccagccgcagcagggcttcgccgcccagacc
tccgcggccacggtcatcctggcctcctcgcacctcggtttctccctgtccacgacgcac
tccgtctccggcgccgtgatgggcgctgggctcggccgcaagggcggtgtcgtccgctgg
tcgaccgcgacgcggatgttcgtcgcctggggtctgacgctgccggcggcggccctggtg
ggcgctctcgccgagtacgtcaccggcttcggcgcctggggcaccgcggtggtggccgtc
ttcctcgtctcctccagcgcggccatctggaagctgtcgcggcgggagatcgtcgaccac
accaacgtcaacgacaccgacgacgccgagcccgcgggcgtggtcaccacggcgatggcc
gcggtgacgccgccgccggccggcacgccggcggaggagccggtgccgtcgttcccggcc
caggccaccgccgagcggacggcctccacgaccaccacggtctga

DBGET integrated database retrieval system