KEGG   Streptomyces qaidamensis: A4E84_11630Help
Entry
A4E84_11630       CDS       T04777                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00361  Chlorocyclohexane and chlorobenzene degradation
stsi00625  Chloroalkane and chloroalkene degradation
stsi01100  Metabolic pathways
stsi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A4E84_11630
   00361 Chlorocyclohexane and chlorobenzene degradation
    A4E84_11630
Enzymes [BR:stsi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A4E84_11630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase
Motif
Other DBs
NCBI-ProteinID: AMW10108
UniProt: A0A143BXZ8
Position
2660621..2661334
Genome map
AA seq 237 aa AA seqDB search
MAAIRDIEVVVFDVLGTMVDEPGGLRSAVREATGLSGRTATDELVALWRRHCEQEQERVR
QGQRPYASTEVLDAEAARLVARHAGVTDPGAVARLATAGRRLPAWGDSAAGLERLSRRYP
VMGLSNAGRTALLHLNAHAGLRWHRALSAEAVPAYKPAPEVYRLALDSAGCPPERVLMVA
AHAWDLRGAQAAGMRTAYVHRPAGDPPTGSDDFDGRFDGLVDLVDALTGSRTTEAVE
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatccgcgacatcgaggtcgtcgtcttcgacgtcctgggcaccatggtcgac
gaacccggcgggcttcggtcggcggtacgggaagcgaccggcctgtccggccggacggcc
accgacgagctcgtcgccctgtggcggcggcactgcgagcaggagcaggaacgcgtccgg
cagggacaacgcccgtacgcgagcacggaggtgctcgacgccgaggccgcccggctggtg
gcccggcacgccggggtgaccgacccgggggccgtcgcgcggctcgccacggcggggcgg
cggctgcccgcgtggggcgactccgccgccgggctggagcggctctcgcggcggtacccc
gtgatggggctgtccaacgccggccgcacggccctgctccacctcaacgcgcatgccggg
ctgcgctggcaccgagcactgtcggcagaggccgttccggcctacaagccggcgcccgag
gtctaccggctcgccctcgacagcgccggatgcccacccgaacgcgtgctgatggtcgcc
gcccacgcctgggacctgcgcggtgcgcaggcggccggcatgcgcaccgcctacgtccac
cggccggccggggatccgccgacgggctcagacgacttcgacgggcggttcgacggactg
gtggacctggtcgatgcgctgacgggcagtcggacgacagaggcggtcgagtag

DBGET integrated database retrieval system