KEGG   Streptomyces qaidamensis: A4E84_18085Help
Entry
A4E84_18085       CDS       T04777                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
stsi  Streptomyces qaidamensis
Pathway
stsi00520  Amino sugar and nucleotide sugar metabolism
stsi01100  Metabolic pathways
stsi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A4E84_18085
Enzymes [BR:stsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     A4E84_18085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AMW11246
UniProt: A0A143C170
Position
4136468..4137598
Genome map
AA seq 376 aa AA seqDB search
MLTGATVVLPTGTVENGQVAVDGTRITRVTPENAQVIDVTDHYVIPGFVDIHNHGGGGAS
FTSGSVDDILKGIHTHRLHGTTTLVASTVTGDMDFLTRRAGLLSELAEQGEIAGVHFEGP
FISPCRKGAHSEALLRDPHPTDVRKLIDAARGQARMLTLATELPGGLDSVRLLADHGVIA
AIGHTDATYEQTVEAIDAGATVATHLFNAMPPLGHRSPGPIAALLEDDRVTVELVNDGTH
LHPAALQLAFHHAGADRVAFITDAMDAAGFGDGRYWLGPLEVEVADGVARLVEDGTIAGS
TLTLDRAFQRAVTVDGLSVEDAVTALSATPARLLGMADTIGSLEPGKYADLLILDSAYEV
KGVMRRGEWVVGPQLG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaccggcgcgacagtggtcctcccgaccggaaccgtcgaaaacggccaggtagcc
gtcgacggcacccgcatcacccgggtcaccccggagaacgcccaggtcatcgacgtaaca
gaccactacgtgatccccggcttcgtcgacatccacaaccacggcggcggcggagcctcc
ttcacctccggctcggtcgacgacatcctcaagggcatccacacccaccgcctgcacggc
acgaccaccctggtcgcctccaccgtcaccggcgacatggacttcctcacccggcgcgcc
ggcctgctgagcgaactcgccgagcagggcgagatcgccggcgtccacttcgagggcccg
ttcatctccccctgccgcaagggcgcccactccgaggccctcctgcgcgacccccacccc
acggacgtccgcaagctgatcgacgcggcccggggccaggccaggatgctgacgctggcc
accgaactccccggcggcctggactccgtacgcctcctcgccgaccacggcgtgatcgcg
gcgatcggccacacggacgccacgtacgaacagacggtcgaggccatcgacgcgggcgcc
accgtcgccacccacctcttcaacgcgatgcccccgctcggccaccgctcccccggcccg
atcgcggccctcctggaggacgaccgggtcacggtcgagctggtcaacgacggcacgcac
ctccaccccgccgcgctgcagctggcgttccaccacgcgggagcggaccgcgtggcgttc
atcacggacgcgatggacgcggccggtttcggcgacggacgctactggctgggcccgctg
gaggtggaggtcgcggacggcgtggcccggctcgtggaggacggcacgatcgccggctcg
accctcacgctggaccgcgccttccagcgggcggtcacggtcgacggcctgtccgtcgag
gacgcggtgacggccctgtccgccacccccgcccggctgctcggcatggccgacacgatc
ggctcactggagcccgggaagtacgccgacctgctgatcctggactccgcgtacgaggtg
aagggcgtgatgcgccggggtgaatgggtggtgggtccccaactgggctga

DBGET integrated database retrieval system