KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0376Help
Entry
t0376             CDS       T00121                                 

Gene name
dapE
Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00300  Lysine biosynthesis
stt01100  Metabolic pathways
stt01120  Microbial metabolism in diverse environments
stt01230  Biosynthesis of amino acids
Module
stt_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    t0376 (dapE)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     t0376 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AAO68094
UniProt: Q8Z4S2
Position
complement(445715..446842)
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDVGCQALMIERLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLNELVAIEWDRGNDFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDEMIKERVHALLEKHQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgtaggctgtcaggcattaatgattgaacgcctgcgtaaaatcggttttaccatt
gagcatatggattttggcgacacgcaaaatttttgggcatggcgtgggcgtggcgaaacg
ctggcgttcgccgggcatactgacgtcgtaccggctggcgatgtcgatcgctggatcaat
ccgccgtttgaacctacgattcgcgacggaatgttgttcggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggctgctgaacgttttgttgcacagcatcctcat
caccggggccgcctcgcatttttgattacctctgatgaagaagccagcgcaaaaaatggc
accgtaaaggtggttgaagcgctgatggcccgtaacgagcggctggattactgtctggtc
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaacgggcgtcgcggttcc
ctcacctgtaacctcactattcatggcgttcaggggcacgttgcctatccgcatctggcg
gataaccctgttcatcgcgccgcgccttttctcaatgaactggtcgctatcgagtgggat
cggggcaatgactttttcccggccaccagtatgcagatagccaatatccaggcaggcacc
ggcagcaataatgtcattcccggcgaactgttcgtgcagtttaacttccgttttagcacg
gagctgaccgatgagatgatcaaagaacgggtacatgcgctgcttgagaagcatcagcta
cgctataccgtagactggtggctttccggtcagccgttcctgaccgcacgcggaaagctg
gtggacgcggtggtaaacgccattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtccgacggacgttttatcgcccgtatgggagcgcaggtggtagaactg
gggccggtgaacgccaccattcataaaattaacgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgtattatggaacagctcgtcgcctga

DBGET integrated database retrieval system