KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0475Help
Entry
t0475             CDS       T00121                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00071  Fatty acid degradation
stt00280  Valine, leucine and isoleucine degradation
stt00281  Geraniol degradation
stt00362  Benzoate degradation
stt00592  alpha-Linolenic acid metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01212  Fatty acid metabolism
Module
stt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    t0475
   00592 alpha-Linolenic acid metabolism
    t0475
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    t0475
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    t0475
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    t0475
   00642 Ethylbenzene degradation
    t0475
Enzymes [BR:stt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     t0475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AAO68182
UniProt: Q8Z4Y9
Position
548181..549491
Genome map
AA seq 436 aa AA seqDB search
MRQALPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPADAIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKALARVLVDVNKARTTRQRLTLFSRLRLRDLLPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWAEGKLAEEVMTTYVPPYKNPFAE
DNNIRGASTLADYAKLRPAFDRKHGSVTAANSTPLTDGAAAVILMTESRAKELGLRPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMADLTLFDMHEAFAAQTLANLQLLGSE
RFAREVFGRAQATGEVDDAKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaggctttaccgttggtcacccgtcagggcgatcgcattgctattgtcagtggg
ttacgaacccccttcgctcgtcaggccactgcatttcatggtattcccgctgttgatctc
ggcaagatggtggtaggcgagctgctggcgcgcagtgaaattccagccgatgccattgag
caactggtttttggtcaggtagtacaaatgccggaagcccccaatattgcgcgcgaaatt
gtgctgggtacgggaatgaatgttcataccgatgcctatagcgtaagccgcgcctgcgcc
accagttttcaggcggtagcgaatgtggcggaaagcctgatggccggcacgatacgcgcg
ggtatcgctggcggcgcagattcgtcgtcggtactgccaataggcgtgagtaaagccctg
gcgcgggtactggttgatgtcaataaagcccggacgacccgccaacggctgacgcttttt
tctcgtctgcgcttacgcgacctgctgcccgttcctcccgccgttgctgagtattccacc
ggtctgcgcatgggcgataccgccgaacagatggcgaaaacgtatggtattacgcgtgaa
cagcaggacgcgctggcgcatcgttcacatcagcgcgccgcgcaggcatgggcggagggt
aaactggcggaagaagtgatgacgacctatgtgccgccgtataaaaacccctttgcagaa
gacaacaacattcgcggtgcctccacgctggcggactacgctaaactgcgtcccgctttt
gaccgaaaacatggctccgtaaccgccgccaacagtacaccgctgaccgacggcgctgcc
gccgttattctgatgaccgaatcccgcgctaaagagctggggctgcgcccgcttggttat
ctgcgcagctacgcctttaccgctattgatgtctggcaggacatgctattggggccggcc
tggtcaacgccgctggcgctggagcgggccgggttgacgatggccgatctgacgcttttt
gacatgcatgaagcgtttgccgctcagactctggcgaacttacaactgctgggcagcgaa
cgatttgcccgtgaggtgtttggtcgtgcgcaggcgacaggggaggtggatgacgctaaa
ttcaacgtgctcggcggctcaatcgcctacgggcatccttttgccgcaacgggcgcgcgg
atgataacccaaacgttgcatgaattacggcgtcggggcggaggttttggcctggtcacg
gcctgcgcggctggcggtcttggcgcggcgatggttctggaggcggaataa

DBGET integrated database retrieval system