KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t0616Help
Entry
t0616             CDS       T00121                                 

Gene name
dsbE
Definition
(GenBank) thiol:disulfide interchange protein
  KO
K02199  cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:stt03110]
    t0616 (dsbE)
Chaperones and folding catalysts [BR:stt03110]
 Protein folding catalysts
  Protein disulfide isomerase
   t0616 (dsbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Redoxin AhpC-TSA Thioredoxin_2 Thioredoxin Thioredoxin_8 Thioredoxin_7 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AAO68321
UniProt: Q8XFE5
Position
698772..699329
Genome map
AA seq 185 aa AA seqDB search
MKRNVLLLPLLIFLLIAAALLWQLARNAQGDDPTNLESALTGKPVPAFRLESLETPGQYY
QAEVLTQGKPVLLNVWATWCPTCRAEHQYLNRLAAQGIRVVGLNYKDDRAKAVAWLKELG
NPYALSLSDSDGMLGLDLGVYGAPETFLIDGRGIIRYRHAGDLNARVWESELKPLWDRYS
REAAQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaacgtactgttattaccgctgctgatttttctgctgattgccgcggcgctg
ctgtggcagctggcgcgcaacgcgcagggggatgacccgacgaatctcgaatcggcgctg
accggaaagccggtgccggcgtttcgcctggaatcgctggagacgccgggtcagtactat
caggcggaggtgctgacgcaggggaaaccggtgctgcttaacgtctgggccacctggtgc
ccgacctgccgcgccgagcatcagtacctgaaccggctggccgcgcagggtatccgggtg
gtggggctgaactataaggacgaccgggcgaaggcggtggcctggttaaaggaactgggc
aacccgtatgcgctgagtttatcggacagcgacgggatgctggggctggacctgggcgtg
tacggcgcgccggaaaccttcctcatcgacggcagggggattatccgctaccgccatgcg
ggcgatttgaatgcccgggtatgggaaagtgaactgaaaccgctgtgggacagatacagc
cgggaggcggcgcaatga

DBGET integrated database retrieval system