KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2595
Entry
t2595             CDS       T00121                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stt02044]
    t2595
Secretion system [BR:stt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   t2595
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: AAO70172
UniProt: Q8Z977
Position
2673143..2673637
AA seq 164 aa
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGD
IDARRYPQAAASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLL
DEARQGSYNTLQFEIRGQILTQPYPTEFLVRSALDMELSRITFF
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagcacgtctcgttttacacccgctaaccacctgctgcctacgctgtttgatcggctg
tgtgacaatgctccgtatcagaaaattgaccgggatatcagcgtcacgccggtacaactg
aaggagatcattcgtcgggatctctcctttttgctcaataccattagccacgagggtgac
atcgacgcccggcgctatccgcaggcggcggcgtcagtgctcaactatggcctgccgccg
ctggcgggcagctttatgtatgagcacaagtgggacgatatcagcgaggcgatccggcgc
gccattatccgtttcgaaccccggctgaacgccgccacactcagggtcacgcccttgctc
gatgaagcccggcagggtagctataacacgctacagtttgaaattcgcggacaaattctg
acgcagccgtatcccacggagtttctggtacgcagcgcgctggatatggagctgagccgc
attacgttcttttaa

DBGET integrated database retrieval system