KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2596
Entry
t2596             CDS       T00121                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stt02044]
    t2596
Secretion system [BR:stt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   t2596
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AAO70174
UniProt: Q8Z979
Position
2675533..2676528
AA seq 331 aa
MTGALDQAQKAPWRYGFLNLMRRVDAQLCDTPAGSIWQPRMEKFRLGQTPTMTFAPREIA
QVSWQDGRLHLSLYSLGLWGPNGPLPLHYTELALNRSESRHDPTLVHFSNIFHYRWLTQF
WQAWRSGQSAGGGLDKPEHDRFAFYIASISGQDLRESAESPLSDHVRLAASAHLVRESRN
PDGLAATLAHYFSVPFAVKEFALHWITVANDEITRLGTPAQSSVLGNGALIGQAVPDMQY
KFRLIIGPLTLEDYLRFLPGGNNLPVLTELVRTFIGFEYCWEIELQLKPHAAPPAVIGGA
QRLGWTAWAGKAMHDRPVTGMIFEPEHGLTH
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaccggcgctctcgaccaggcgcagaaagccccctggcgttacggattcctgaacctg
atgcgacgcgtggatgcccagctctgtgatactccggcaggcagtatctggcagcctcgg
atggaaaaattccgtctgggacagacgccgacgatgacctttgcaccacgggaaatcgcc
caggtcagctggcaggatggacgcctgcacctgagcctgtacagcctcggactatggggg
ccaaacggcccgttgccgctgcactataccgagctggcgctaaatcgctcagagagtcgt
cacgatccgacgctggttcatttttccaatatttttcactaccgctggctgacgcagttc
tggcaggcatggcgcagcggccagtccgctggtggcgggctggacaaaccggaacacgac
cgttttgcgttttatatcgccagtatcagcgggcaggatctacgggaaagcgccgaaagc
ccgctgtcagatcatgttcgcctggcggcctccgcccatctggtacgcgagtcgcgcaat
cctgacgggctggccgccacgctggcgcactatttcagcgtaccttttgcggtgaaagag
tttgccctgcactggataacggtggcgaacgatgaaatcacccgtctgggcacgcccgcg
cagtcttcggtgctgggcaacggggcgcttatcggccaggccgtaccggatatgcagtac
aaattccggctaattatcggcccgctcacgctggaggattacctgcgttttctgcccggc
ggcaacaatctgcccgtgctgacagaactggtgcgtacgttcatcggttttgaatattgc
tgggaaattgagctgcagttgaagccccatgccgcaccgcctgcggtgatcggcggcgcg
cagcggcttggctggacggcctgggcaggtaaagccatgcatgaccgtccggtgaccggc
atgatttttgaacctgaacacggcttaacccactga

DBGET integrated database retrieval system