KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2598
Entry
t2598             CDS       T00121                                 

Definition
(GenBank) hypothetical protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AAO70175
UniProt: Q8Z980
Position
2676539..2676961
AA seq 140 aa
MDMSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDAR
RLLTRSKDIRVLILLLRSRIQQAGAQGLAEMLTQLAELSVIWSDALHPQLLTGEGASAES
IEDAALARSNALAARWITKA
NT seq 423 nt   +upstreamnt  +downstreamnt
atggacatgtccctgactaaaccggtaagcgcggaacaaccctgcggccccgatccggag
tacgatccggaatacctgctgctgttcagccgcgccgccccccaggcggaggcgcaatat
ggtgattttgtcagtacgccggaagccgtgaactggccggaaattgagcgtgatgcgcgc
cgtctgctcacgcgcagtaaggatatccgggtgttgatcctgctgctgcgcagtcgcatc
cagcaggctggcgcacagggactggcggaaatgctcacacaactggcagaactgagcgta
atctggtctgatgcactccatccacagctgcttaccggcgaaggcgcatccgcagaatct
attgaagatgcggcgctggcgcgcagtaatgccctggcggcgcgctggatcacgaaggcg
tga

DBGET integrated database retrieval system