KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2599
Entry
t2599             CDS       T00121                                 

Definition
(GenBank) hypothetical protein
  KO
K11902  type VI secretion system protein ImpA
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stt02044]
    t2599
Secretion system [BR:stt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   t2599
SSDB
Other DBs
NCBI-ProteinID: AAO70176
UniProt: Q8Z981
Position
2676961..2677593
AA seq 210 aa
MADIRGITLSNSAALHLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFRE
AQESAERLQVWARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPAPAPAGTVMD
NAIPARAEDVPPVNAPPGISIPHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLL
RQAERLVGKRFSEVINEIPVELLEKWDALE
NT seq 633 nt   +upstreamnt  +downstreamnt
atggcagacattcgcggtatcacgctgtcaaacagtgccgccctgcacctgcaggtacgg
gacgtggagcgcgcgttatccgcccctcgcccggctgatgcgctggcccccgaatccgtc
cgccagcaactggcagacctcgaagcccgtggggcattaccgctagcggcgtttcgcgaa
gcgcaggaaagcgcagaacgcctgcaagtgtgggcgcgtgagacattaggcgatctggct
ccagatttttcacgcctgcggcagttgttagcgctgctgcctgacgtggtacagacaacc
acgccggaaatccctccgtcgccagcgccagcgccagctcccgcaggcacggttatggat
aatgccattcctgcacgggcagaggatgtgccgcctgtcaacgcgccacccggtatatct
atcccacacaatgctgaaccggggccaattcgcgatcgtaatgatgcgctggaacgcctg
cggtgcattcgtcgctggtttgagagcagtgaacccagcagcccgaccatcccactatta
cgtcaggctgaaagactggtgggaaaacggttctcggaggtgatcaatgagatcccggtg
gagttgctggagaagtgggatgccctggagtga

DBGET integrated database retrieval system