KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2763
Entry
t2763             CDS       T00121                                 

Gene name
sitA
Definition
(GenBank) iron transport protein, periplasmic-binding protein
  KO
K11604  manganese/iron transport system substrate-binding protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:stt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    t2763 (sitA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stt02000]
    t2763 (sitA)
Transporters [BR:stt02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese/iron transporter
    t2763 (sitA)
SSDB
Motif
Pfam: ZnuA
Other DBs
NCBI-ProteinID: AAO70324
UniProt: Q9XCS2
Structure
PDB: 
5JG7

Position
2845119..2846036
AA seq 305 aa
MTNLHRLKTLLIAGIVAILALSPAYAKEKFKVITTFTVIADMAKNVAGDAAEVSSITKPG
AEIHEYQPTPGDIKRAQGAQLILANGLNLERWFARFYQHLSGVPEVVVSTGVKPMGITEG
PYNGKPNPHAWMSAENALIYVDNIRDALVKYDPDNAQIYKQNAERYKAKIRQMADPLRAE
LEKIPADQRWLVTSEGAFSYLARDNDMKELYLWPINADQQGTPKQVRKVIDTIKKHHIPA
IFSESTVSDKPARQVARESGAHYGGVLYVDSLSAADGPVPTYLDLLRVTTETIVNGINDG
LRSQQ
NT seq 918 nt   +upstreamnt  +downstreamnt
atgacgaatctacatcgtctaaaaacactcctgattgccggtattgtcgcgatactcgcg
ctatcgccagcctatgcaaaagagaaatttaaagtcatcaccacgtttaccgttattgcc
gacatggcgaaaaacgtggcgggcgacgcagcggaagtcagctcgattaccaagcccggc
gctgaaatccatgagtatcagccaacgcccggcgatattaaacgagcgcagggggcacag
cttatcctcgcgaatggtctgaacctggagcgatggttcgcccgcttttatcagcacctt
tccggtgtaccggaagtcgtcgtctccaccggcgtcaaaccgatgggcattaccgaaggc
ccgtataacggtaaaccgaacccgcacgcctggatgtcggcagaaaacgcgctgatttat
gtcgataacattcgcgacgccctggtgaagtacgatccggataatgcgcagatctataag
caaaatgccgaacgctataaagcgaaaattcgccagatggccgatccgttgcgtgccgag
ctggaaaaaattcccgccgatcagcgctggctggtcaccagtgaaggcgcgttctcttac
ctggcgcgcgataacgacatgaaagagctttatctctggccaattaacgccgatcaacag
gggacgccaaaacaggtgcgtaaagtgattgataccattaaaaagcaccatattcccgcc
atctttagcgagagtacggtttccgataaacccgcccgccaggtcgcgcgtgaatccggc
gcgcattatggcggcgtactgtatgtcgattctctgagcgccgctgacggccctgtgcca
acctatctggatctgctgcgcgtcacgaccgaaaccatcgtcaacggcattaacgacgga
ctgaggagtcaacaatga

DBGET integrated database retrieval system