KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t2828Help
Entry
t2828             CDS       T00121                                 

Gene name
surE
Definition
(GenBank) stationary phase survival protein
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00230  Purine metabolism
stt00240  Pyrimidine metabolism
stt00760  Nicotinate and nicotinamide metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    t2828 (surE)
   00240 Pyrimidine metabolism
    t2828 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    t2828 (surE)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     t2828 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AAO70385
UniProt: P66882
Structure
PDB: 

Position
complement(2903908..2904669)
Genome map
AA seq 253 aa AA seqDB search
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFDNGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLNGYQHYDTAAAVTCALLRGLSREPLRTGRILNVNVPDLPLAQVKGIRVTRCGSRH
PADKVIPQEDPRGNTLYWIGPPGDKYDAGPDTDFAAVDEGYVSVTPLHVDLTAHSAHDVV
SDWLDSVGVGTQW
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatattgctgagtaacgatgacggggttcacgcgcccggtatacaaacgctggcg
aaagcgctgcgtgagtttgctgatgtacaggtcgtagccccggatcgtaaccgcagcggc
gcgtctaattccctcacgctggaatcttcgcttcgtacttttacctttgataatggcgat
atcgctgtacagatggggacgccgaccgattgcgtctatctgggcgttaatgccttaatg
cgtccgcgtccggatattgtcgtttccggtattaacgcgggtccgaatctgggcgatgat
gtgatctattccggtactgtcgccgcggcgatggaaggtcgtcatctcggctttccggca
ttagcggtctcccttaacggctatcagcattatgatacggctgcagccgtgacttgcgcg
cttttgcgagggttaagccgggagccgttgcgtaccgggcgtattctcaacgtgaatgtc
ccggatctaccgttagcgcaggttaaaggcatccgcgtgactcgctgcggtagccgccat
ccagcggataaagtgatcccgcaggaagatccacgcggtaatacattgtactggattggc
ccgccgggtgataaatacgatgccgggccggataccgatttcgcggcggtggatgaaggc
tacgtctccgtcacgccgttgcatgtggatttaaccgcgcacagcgcgcatgatgtggtt
tcagactggttagacagcgtgggagttggcacgcaatggtaa

DBGET integrated database retrieval system