KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3052
Entry
t3052             CDS       T00121                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:stt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    t3052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:stt02044]
    t3052
Secretion system [BR:stt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   t3052
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAO70598
UniProt: Q8Z3S0
Position
complement(3132317..3132802)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIKWQITAEKSDGAQQESRASVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgtgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcaaatggcaaatcactgccgagaaatca
gacggcgctcaacaggagtccagagcgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system