KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3575Help
Entry
t3575             CDS       T00121                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00010  Glycolysis / Gluconeogenesis
stt00071  Fatty acid degradation
stt00350  Tyrosine metabolism
stt00625  Chloroalkane and chloroalkene degradation
stt00626  Naphthalene degradation
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
stt01130  Biosynthesis of antibiotics
stt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    t3575
  Lipid metabolism
   00071 Fatty acid degradation
    t3575
  Amino acid metabolism
   00350 Tyrosine metabolism
    t3575
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    t3575
   00626 Naphthalene degradation
    t3575
Enzymes [BR:stt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     t3575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Glycolytic
Motif
Other DBs
NCBI-ProteinID: AAO71078
UniProt: Q8Z2V2
Position
3676049..3677197
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVKLGLLDSLFSALDEHQMS
YHLFDEVFPNPTEELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVML
EIPASVTAATGMDALTHAVEAYVSVGAHPLTDANALEAIRLINVWLPKAVDDGHNLEARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIVENFNRPNAVARFA
RIAQAMGVETRGMSDEVASQEAINAIRTLSKRVGIPEGFSKLGVTKEDIEGWLDKALADP
CAPCNPRTASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttatgttggcactgccaaaaattagcctgcatggcgctggagcgattgccgat
atggtgaacctcgtggcgaataagcaatggggcaaagcgctgatcgttaccgatggtcaa
ctggtaaagctgggcctgctggatagcctgtttagcgcactggatgaacatcaaatgtct
taccacctgtttgatgaggtgttcccaaacccgacagaagagctggtgcagaaaggtttt
gcggcgtatcagagcgcagaatgtgactacattatcgccttcggcggcggcagcccgatc
gataccgcaaaagcggtgaaaattctgaccgccaacccaggtccatctaccgcctactcc
ggcgtcggcaaagtgaaaaacgccggcgtaccgctggtagcgattaacactacggcaggt
accgcggcagagatgaccagcaacgcggtgattatcgactctgcccgtaaggtcaaagag
gtgatcatcgacccgaatatcatcccggatattgccgtggatgacgccagcgtcatgctg
gaaatcccggcgtctgtgaccgccgcaaccggcatggatgccctgacccatgcggtggaa
gcctatgtctccgttggcgcgcatccgctcaccgacgctaacgcgctggaagcgattcgc
ttaatcaatgtgtggctaccgaaagcggttgacgatggtcataacctcgaagcccgtgag
caaatggcattcggccagtacctggcgggtatggcgttcaacagcgccggtttggggctg
gttcacgcgctggcgcaccagccgggcgcaacccacaacctgccgcacggcgtctgcaac
gctatcctgctgccaattgtcgagaactttaaccgtccgaacgccgtcgcgcgttttgcc
cgcatcgcacaggcgatgggcgtggagacgcgcggtatgtctgacgaagtcgcaagtcag
gaagcgattaacgctatccgtacgctgagcaaacgcgtcggcattccagaaggtttcagc
aagctgggcgtcacaaaagaagatatcgaaggctggctggataaagccctcgccgacccg
tgcgcgccgtgtaacccgcgcaccgccagccgcgatgaagttcgcgagctgtacctggag
gcgttatga

DBGET integrated database retrieval system