KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3726
Entry
t3726             CDS       T00121                                 
Name
(GenBank) probable permease
  KO
K02429  MFS transporter, FHS family, L-fucose permease
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:stt02000]
    t3726
Transporters [BR:stt02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Fucose:H+ symporter (FHS) family [TC:2.A.1.7]
    t3726
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-ProteinID: AAO71219
UniProt: Q8XEV7
Position
3840647..3841963
AA seq 438 aa
MNDKNIVQMPDGYLNKTPLFQFILLSCLFPLWGCAAALNDILITQFKSVFSLSNFASALV
QSAFYGGYFLIAIPASLVIKKTSYKVAILIGLTLYIVGCTLFFPASHMATYTMFLAAIFA
IAIGLSFLETAANTYSSMIGPKAYATLRLNISQTFYPIGAAAGILLGKYLVFSEGESLEK
QMAGMNAEQVHNFKVLMLENTLEPYKYMIMVLVVVMVLFLLTRFPTCKVAQTASHKRPSA
LDTLRYLASNARFRRGIVAQFLYVGMQVAVWSFTIRLALELGDINERDASTFMVYSFACF
FIGKFIANILMTRFNPEKVLILYSVIGALFLAYVALAPSFSAVYVAVLVSVLFGPCWATI
YAGTLDTVDNEHTEMAGAVIVMAIVGAAVVPAIQGYVADMFHSLQLSFLVSMLCFVYVGV
YFWRESKVRGNLAEVAAS
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaacgataaaaacatcgttcagatgcccgacgggtatctgaataagacacctctgttc
cagtttattttgttatcctgtttattcccgttatggggatgcgcagccgcgttaaatgat
attctgattacgcaatttaaaagtgtattttcgctgagcaactttgcttcggcattagta
caaagcgccttttatggcggttattttttaattgctattccggcctcgctggtcattaaa
aaaaccagttataaagtggcgatacttatcggcctgacgctatacattgtcggctgtacg
ctcttttttccggcgtcgcacatggcgacctacaccatgttcctcgcggcgattttcgcc
attgcgattggcctgagtttcctggaaacggcggcgaatacctacagttcgatgatcggg
ccgaaagcctacgccacgctgcggctgaatatcagccagaccttttatccgatcggcgcg
gcggcaggcattttattgggtaagtatctggtcttttccgaaggggaaagcctggaaaaa
cagatggcgggcatgaatgccgagcaagtccacaacttcaaggtgttgatgctggaaaac
actctggaaccctataagtacatgattatggttctggtagtggtgatggtactgttcctg
ctgacgcgttttccgacctgtaaagttgcgcaaaccgcgagtcataaacgtccctcggcg
ctggatacgctacgctatctcgccagtaacgcccgcttccgtcgcggtattgtggcgcag
ttcctgtatgtgggaatgcaggtggcggtctggtcgttcactattcgtctggcgctggag
ttaggcgatatcaatgagcgcgatgcctcaacctttatggtctacagcttcgcctgcttt
tttatcggcaagtttatcgccaacattctgatgacgcgcttcaacccggaaaaagtcctg
atcctttactctgtgatcggcgcgctgttcctggcctatgtggcgctggcgcccagcttt
agcgcggtatacgtggcggtgctggtcagtgttctgtttggcccctgctgggcgaccatt
tatgccggaacgctcgataccgtcgataacgagcataccgaaatggcgggggcggtcatc
gtgatggcgattgtcggcgcggcggtggttcccgcgattcagggctacgtggcggacatg
ttccactcgttacagctctcattcctggtttccatgctgtgctttgtttacgttggcgtt
tacttctggcgcgaaagcaaagtgcgcggcaacctggctgaagtcgccgcgtcctga

DBGET integrated database retrieval system