KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t3873Help
Entry
t3873             CDS       T00121                                 

Gene name
yiaE
Definition
(GenBank) putative 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00030  Pentose phosphate pathway
stt00260  Glycine, serine and threonine metabolism
stt00620  Pyruvate metabolism
stt00630  Glyoxylate and dicarboxylate metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
stt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    t3873 (yiaE)
   00620 Pyruvate metabolism
    t3873 (yiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    t3873 (yiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    t3873 (yiaE)
Enzymes [BR:stt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     t3873 (yiaE)
    1.1.1.81  hydroxypyruvate reductase
     t3873 (yiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     t3873 (yiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AAO71351
UniProt: Q8Z2A8
Position
complement(3999261..4000235)
Genome map
AA seq 324 aa AA seqDB search
MKPSIILYKTLPDDLLHRLEAHFTVTQVPNLHPETVARHAQAFASAQGLLGTSETVNRAL
LEKMPALRAASTISVGYDNVEVDALTARKIVLMHTPAVLTETVADTVMALMLATARRVVD
VAERVKAGEWTESIGPAWFGVDVHHKTLGIVGMGRIGMALAQRAHFGFTMPVLYHARRRH
QEAEDRFNARYCDLDTLLQEADFVCVILPLTAETRHLFGATQFARMKSSAIFINAGRGPV
VDENALIAALQNGEIYAAGLDVFEQEPLSVDSPLLNMSNVVAVPHIGSATHETRYNMMAC
AVDNLIDALQGKIEKNCVNPQAAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccatcattctctacaaaaccctgcctgatgatttgctgcatcgcctggag
gcgcattttaccgtcacccaggtaccgaacctgcatccggaaacggtcgcgcgacacgcg
caggcatttgccagcgcgcaaggccttctgggcaccagcgaaaccgttaaccgcgcgctg
ctggaaaaaatgccggcgctacgcgcggcgtcgaccatctcggtgggatacgataatgtc
gaggtggacgcccttactgcccgcaaaatagtcctgatgcacacgcctgccgttttgacg
gaaaccgttgccgatacggtgatggcgttgatgctggccactgcccgccgcgtggtggac
gtcgcagaacgggttaaggcgggtgaatggacagaaagcattggcccggcatggtttggc
gtcgatgtgcatcacaaaacactcggtatcgttgggatggggcgtatcgggatggcgctg
gcgcagcgagcgcactttgggtttaccatgccggttctctatcacgcccgtcggcggcat
caggaggcggaagaccggtttaacgcccgctactgcgatctggatacgttgttgcaggag
gccgattttgtctgcgtgatcctgccactaacggcagaaacgcgacatctgtttggcgca
acacagtttgccagaatgaaatcgtccgccatttttattaatgccggacgcggcccggtg
gtcgatgaaaacgcgctgattgccgcgctgcaaaacggtgaaatatatgcggcaggtctg
gatgtctttgaacaggaaccgctatctgtggattcgcccctgctgaacatgtctaatgtc
gtcgcggtgccgcatattggctcggcaacgcatgagacgcgctacaacatgatggcctgt
gcggtggataatttgattgatgcgctgcagggaaaaatagagaagaactgcgtcaatccg
caagcggcgggataa

DBGET integrated database retrieval system