KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4010Help
Entry
t4010             CDS       T00121                                 

Gene name
yrfG
Definition
(GenBank) putative hydrolase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00230  Purine metabolism
stt00240  Pyrimidine metabolism
stt00760  Nicotinate and nicotinamide metabolism
stt01100  Metabolic pathways
stt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    t4010 (yrfG)
   00240 Pyrimidine metabolism
    t4010 (yrfG)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    t4010 (yrfG)
Enzymes [BR:stt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     t4010 (yrfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AAO71480
UniProt: Q8Z212
Position
complement(4162190..4162900)
Genome map
AA seq 236 aa AA seqDB search
MLPCRANCVTLEFPMHIDIDWQNVDTVLLDMDGTLLDLAFDNYFWQKLVPETYGAQQGIS
PQDAQEYIRQQYHAVQHTLNWYCLDYWSERLGLDICAMTTAQGPRAVLRDDTVPFLNALK
ASGKRRILLTNAHPHNLAVKLEHTGLASHLDLLLSTHTFGYPKEDQRLWRAVTEETGISA
EKTLFIDDSEPILDAAARFGIRYCLGVTNPDSGLAEKHYTRHPSLNDYRRLIPSLK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgctaccctgtcgcgcaaattgcgttaccctggagttccccatgcatattgatattgac
tggcaaaacgtggataccgttttgctggatatggacggcacgctgctcgatctcgcgttc
gataactatttctggcaaaagctggtaccggaaacctacggcgcgcagcagggtatttcg
ccgcaggacgcgcaggaatatattcgccagcagtatcatgccgtacagcatacgctaaac
tggtactgtctggattactggagcgagcgtctgggtctggatatttgcgccatgacgacg
gcgcaagggccgcgcgccgttttgcgcgacgataccgtaccgtttctgaatgcgttaaaa
gccagcggaaaacgtcggattctgctcaccaatgcgcatccacataacctggcggtgaag
ctggagcataccggtctggcctcacaccttgatttattactttccacccacacatttggt
tatcccaaagaggatcagcggttatggcgcgctgtcactgaggaaacgggaataagcgca
gagaaaacgctgtttatcgatgacagcgaaccgattctcgacgccgccgcccggtttggt
attcgctactgtcttggcgtgacgaatcccgattccggtctggcggaaaagcactatacg
cgccatccgtccctgaacgactaccgccgtctgatcccctcgctgaagtga

DBGET integrated database retrieval system