KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4052Help
Entry
t4052             CDS       T00121                                 

Gene name
fkpA
Definition
(GenBank) FKBP-type peptidyl-prolyl isomerase
  KO
K03772  FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC:5.2.1.8]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Brite
KEGG Orthology (KO) [BR:stt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:stt03110]
    t4052 (fkpA)
Enzymes [BR:stt01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     t4052 (fkpA)
Chaperones and folding catalysts [BR:stt03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    t4052 (fkpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C FKBP_N BURP
Motif
Other DBs
NCBI-ProteinID: AAO71519
UniProt: Q8Z1Y4
Position
4208461..4209279
Genome map
AA seq 272 aa AA seqDB search
MKSLFKATLLATTMAVAMHVPITFAADAAKPAATADSKAAFKNDDQKAAYALGASLGRYM
ENSLKEQEKLGIKLDKDQLIAGVQDAFADKSKLSDQEIEQTLQTFEARVKSAAQAKMEKD
AADNEAKGKTFRDAFAKEKGVKTSSTGLLYKVEKEGTGEAPKDSDTVVVNYKGTLIDGKE
FDNSYTRGEPLSFRLDGVIPGWTEGLKNIKKSGKIKLVIPPALAYGKTGVPGIPANSTLV
FDVELLDIKPAPKADAKPADAADAKAADAAKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcactgtttaaagccacgctgctggcaacgacgatggccgttgctatgcacgta
ccgatcacttttgctgctgatgcggcgaaaccggcagctaccgctgatagcaaagcagca
tttaaaaacgacgatcaaaaagcggcttatgcgctgggcgcctcgctgggtcgttacatg
gaaaattcgcttaaagagcaggaaaagttgggcatcaaactggataaagatcagttgatt
gccggcgttcaggatgcctttgccgataagagcaaactgtccgatcaggaaattgagcaa
acgctgcagacgtttgaagcacgtgtgaagagcgctgctcaggcgaagatggaaaaagac
gctgccgataacgaagcaaaaggtaaaacgttccgtgacgcttttgctaaagagaaaggc
gtgaaaacctcctctaccggtctgctttacaaagtagagaaagaaggcacaggcgaggcg
ccgaaagatagcgataccgttgtggtgaactacaaaggtacgctgatcgacggtaaagag
tttgataactcttacacgcgcggcgaaccgctctccttccgtctggacggcgttatccct
ggctggactgaaggcctgaaaaatattaagaaaagcggcaagatcaagctggttatccca
ccggcgctggcctacggtaaaacgggcgttccgggtatccctgcgaactccaccctggta
ttcgacgtagagctgctggatatcaaaccagcgccgaaagcggatgctaaacctgccgat
gcggctgacgctaaagccgcagatgctgctaaaaaataa

DBGET integrated database retrieval system