KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4256Help
Entry
t4256             CDS       T00121                                 

Definition
(GenBank) putative exported protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAO71714
UniProt: Q8Z1K6
Position
4424231..4424971
Genome map
AA seq 246 aa AA seqDB search
MKPMKSTLNCLRQWTASVMLAVIVSLPALASVSTGRSVSAPQQQNTTTEGRTQTSGTAWG
LSEKEWQQYQQVLKGPRAFQSPGIDPLMALGLEAGSASERRRFAEMWVKEEYARGEKELA
FQREVDAAWKRLYPNTLSVNMGNASGIAHDTQGRLALFVKRNCVPCDARVSAVLADNRPV
DIYLVDSGGSDDTIRQWALAHHIPVDKVRSRQITLNHDNGNWLKYGQGYMPVMLQQGVSG
WQIAAF
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatgaaatcaacgttaaattgcctccggcagtggactgcgtcagtcatgctg
gctgttatcgtaagtctgcctgctcttgcatcagtgagtacgggtcgcagtgtaagcgca
ccccagcagcaaaatacgactacagaaggaaggacgcaaacgtcaggaacggcatgggga
ctcagcgaaaaagaatggcagcagtatcaacaggtacttaaaggtcccagagcatttcag
tcacctggcattgacccgttgatggcactggggctggaggccggttcggcaagcgaacgc
cggcgttttgctgaaatgtgggtgaaggaagagtatgcccggggtgaaaaggagctggcc
tttcagcgggaagtggatgctgcctggaaacgcctttatcccaatactctctccgtaaac
atgggcaatgccagcggtattgcccatgatacacagggaagactggcgttatttgtgaag
cgcaactgtgtaccgtgcgatgccagagtaagtgcggttctggcagataaccgtccggtt
gatatttacctggtcgacagtggcggcagtgatgacaccattcgccagtgggcgcttgca
catcatattccggtcgataaagttcgtagccggcagataaccctcaaccacgataacggc
aactggctgaagtatggtcagggatatatgccggttatgcttcagcagggagtctccgga
tggcaaatcgcagcattctga

DBGET integrated database retrieval system