KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4261Help
Entry
t4261             CDS       T00121                                 

Definition
(GenBank) putative membrane protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4400
Motif
Other DBs
NCBI-ProteinID: AAO71719
UniProt: Q8Z1K1
Position
4428858..4429616
Genome map
AA seq 252 aa AA seqDB search
MSTEKNSSQSSPPPRKPPGLLTLVLWIWPVRLLAFLLVSWMAGVFIEWAGMFFFWSDQGA
LHSQSVMNKELGYLSADFTQSLIFSSPSVTTMGWISSAYQWAFVDSGLLTWIQKEQRETL
SSSDSVVFFLGQVQAWLLSVLSDYLLALVYVTVVFAVRVLILVLSIPLFVLVIIVAVIDG
LCRRDLRRYGAGYESSFLYHHAKRFVKPAVYLPCLLYLSWPASIYPNLLLLPGALLLGLA
VTVVTSTFKKYL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaaaaaacagctctcaaagttctccaccaccgcgcaagccaccaggtttg
ctgacccttgttttgtggatctggccagtcaggcttttggcttttctgctggtatcctgg
atggctggtgtttttattgaatgggcaggaatgttttttttctggtcagatcagggagct
ttgcattcccagtccgttatgaataaagaacttggctatttatcagcagattttactcaa
agccttattttttcttcaccatcagtaactacgatgggctggatttcgtcagcttaccaa
tgggcatttgtggacagtggattactcacctggattcagaaagaacaaagggagacatta
agcagttctgactctgttgttttttttctgggacaagtgcaggcctggttattatcagtg
ttaagcgattatctgcttgcgctggtttatgtcaccgtcgtttttgccgtcagggtatta
attcttgttttatccatcccgttatttgttctggttatcatcgtcgctgttatagacggg
ttgtgtcgtcgtgacctgagacgttacggggcgggttatgagtcgagttttctgtatcac
catgccaaacggtttgttaaaccggctgtttatctcccttgcttactttacttgtcatgg
cctgcgtcgatttatccaaatctgttacttctgcccggggcattgttactgggactggcg
gttactgtagtgacatctacattcaaaaaatatctgtga

DBGET integrated database retrieval system