KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4274Help
Entry
t4274             CDS       T00121                                 

Definition
(GenBank) hypothetical protein
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAO71732
UniProt: Q8Z1I8
Position
4439479..4440909
Genome map
AA seq 476 aa AA seqDB search
MRSQSILSVCLMLGIVSSGPLSAALLDAPTLSGDGYGKSVNGAVSDKLFYSIGGGSVIST
PGTMYGMKRIGLDAGLSSDLMCGNFDIKTTVGNQLNGVTNGFKDLMGDVITGATGAVSSM
PAMILQRANPGLYEMITNGVLQAGLAFDKSKLNCESMANKLADYTLGDKSSWTESAVREE
YKEAVSASGGDALRAEEARTKASGKEGATWVGGKKAGGKGQPAIQPTRDLAKAGYNMMNN
LSVTSNSTVSAGSCKGSACQKFKNSEEAAAAVVKVLGDRSIRTCKDATECGSGGIDNAQG
TTIAGTGFAPMLEDTTKENLEQLVKLVNGTEAPTQANLDKIKSGSLKVTRGVIDALKRDP
DAGALVQRLAGELAMSDTIETGLAMRRMLTTGQSEPNAADQPQAMAEADRRIEALDRELN
SLKLEMELRREVAKNTALVVVAREENRSVTNPQKESQTNADTRLSELETRKPGDSQ
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcaatccattttatccgtctgtctcatgctgggtatcgtcagttcgggaccg
ttaagtgctgcattactggatgcccccacgttgagtggtgatggatatggaaagtcagta
aatggcgcggttagtgacaagctgttttacagcattggtggtggttcggtgatttccact
cccgggacgatgtacggaatgaaacgtatcgggctggatgccggactgagcagtgatttg
atgtgtggcaactttgatataaagactactgtcggaaaccagcttaatggcgtcacgaat
ggtttcaaagatttgatgggggatgtgatcaccggtgcgaccggggcggtctcaagtatg
ccggcgatgatccttcagcgagcaaatccgggtttgtatgaaatgatcaccaatggtgta
cttcaggcaggtctggcttttgacaaatcgaaactgaattgtgaaagcatggccaacaag
ctggctgattacactttgggtgacaagagcagctggacagaatcagctgtgagggaagag
tacaaggaggcggtcagtgccagtggcggggatgcgctgcgggcagaagaggccagaacc
aaagcttcaggtaaggagggcgctacctgggtaggcgggaagaaagccggagggaaaggc
cagcctgccattcagccaacgcgtgatctggctaaagcaggatacaacatgatgaataac
ctgagcgttaccagcaacagcacggtatccgccggtagttgcaaggggtcagcatgccag
aaatttaaaaactctgaagaagctgcagcagcggtcgtaaaagttctgggcgatcggagt
attcgcacctgtaaagatgccacagaatgcggaagcggcgggattgataatgcccagggc
acgacaattgccggtaccggttttgctcccatgcttgaggatacaaccaaagagaatctg
gaacagctggtaaagcttgtaaatggtactgaggctccgactcaggccaatctggataaa
attaaaagtggcagccttaaggtaacgcgtggtgtcatcgatgccctgaaacgcgatcct
gatgccggtgcgttggttcagagactggctggcgaactggccatgtccgacacgattgaa
accggtctggcgatgcgtcgcatgttaacgactggccagtctgaacccaatgcagctgat
cagcctcaggcaatggctgaagccgatcgccgtattgaagctctcgatcgtgagcttaac
tctcttaagctggagatggaactgcgtcgggaagtggcaaaaaataccgcgctggttgtg
gttgcgcgcgaagaaaatcgttcggtcaccaatcctcaaaaagaatcgcagactaatgct
gatacccggctgagtgagcttgaaacgcgtaaaccaggggacagccaatga

DBGET integrated database retrieval system