KEGG   Salmonella enterica subsp. enterica serovar Typhi Ty2: t4615Help
Entry
t4615             CDS       T00121                                 

Gene name
lplA
Definition
(GenBank) lipoate-protein ligase A
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
stt  Salmonella enterica subsp. enterica serovar Typhi Ty2
Pathway
stt00785  Lipoic acid metabolism
stt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    t4615 (lplA)
Enzymes [BR:stt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     t4615 (lplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lip_prot_lig_C BPL_LplA_LipB
Motif
Other DBs
NCBI-ProteinID: AAO72047
UniProt: Q8Z0U0
Position
complement(4766131..4767147)
Genome map
AA seq 338 aa AA seqDB search
MTTLRLLISDSYDPWFNLAVEECIFRQMPATQRVLFLWRNADTVVIGRAQNPWKECNTRR
MEEDNVRLARRSSGGGAVFHDLGNTCFTFMAGKPEYDKTISTHIVLAALNSLGVMADASG
RNDLVVKTPDGDRKVSGSAYRETKDRGFHHGTLLLNADLSRLANYLNPDKKKLAAKGITS
VRSRVANLTELLPGITHEQVCQAVTEAFFAHYGERIDAEVISPDKTPDLPNFTETFARQS
SWEWNFGQAPAFSHLLDERFTWGGVELHFDVEKGVITRAQAFTDSLNPAPLEALAGRLQG
CQYRADKLQETCEALIATFPEQESELRELANWVAGAVR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacgcctgcttatttctgactcttacgatccctggtttaacctggcggtc
gaggagtgcattttccgccagatgcccgccacccagcgcgtgctgttcctgtggcgcaac
gcggacacggtggtcattggacgcgcgcaaaacccgtggaaagagtgtaatacgcggcgt
atggaagaagataacgtccgtctggcccgccgtagcagtggcggcggcgcggtattccat
gacctcggtaatacctgctttacctttatggccggtaaaccggaatacgataaaaccatc
tccacccatattgtgctcgcggcgctgaattcgctgggcgtcatggccgatgcttcagga
cgcaacgatctggtcgtaaaaacgccggacggcgatcgcaaagtctccggttcagcctat
cgcgaaaccaaagatcgcggcttccatcacggtacgctgctgctgaacgccgacctcagc
cgtctggcaaactatctgaatccggataaaaagaaacttgcggcgaaaggaatcacctcc
gttcgctcccgcgtagccaatcttaccgagttattaccgggtatcacccatgaacaggtc
tgccaggcggtcacggaagcctttttcgcccattacggcgaacgcatcgacgcggaagtg
atttcaccggataaaacgccggatctgccgaattttaccgaaacctttgcgcgccagagc
agttgggagtggaatttcggccaggcaccggcgttcagccatctgctggacgagcgtttc
acctggggcggcgtcgagctgcattttgacgtagagaaaggtgtgattactcgcgcacag
gcgtttaccgatagcctgaacccggcaccgctggaagcgctggcggggcggctgcaaggc
tgccagtatcgggcggataaactacaggaaacgtgcgaagcgctgatagcgacgtttccg
gaacaggagagtgagttgcgggaactggcgaattgggtcgcaggggccgtgcgttaa

DBGET integrated database retrieval system