KEGG   Streptococcus thermophilus JIM 8232: STH8232_1402Help
Entry
STH8232_1402      CDS       T02026                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00010  Glycolysis / Gluconeogenesis
stu00030  Pentose phosphate pathway
stu00051  Fructose and mannose metabolism
stu00052  Galactose metabolism
stu00680  Methane metabolism
stu01100  Metabolic pathways
stu01110  Biosynthesis of secondary metabolites
stu01120  Microbial metabolism in diverse environments
stu01130  Biosynthesis of antibiotics
stu01200  Carbon metabolism
stu01230  Biosynthesis of amino acids
stu03018  RNA degradation
Module
stu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH8232_1402 (pfk)
   00030 Pentose phosphate pathway
    STH8232_1402 (pfk)
   00051 Fructose and mannose metabolism
    STH8232_1402 (pfk)
   00052 Galactose metabolism
    STH8232_1402 (pfk)
  Energy metabolism
   00680 Methane metabolism
    STH8232_1402 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    STH8232_1402 (pfk)
Enzymes [BR:stu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STH8232_1402 (pfk)
Protein phosphatases and associated proteins [BR:stu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STH8232_1402 (pfk)
Messenger RNA biogenesis [BR:stu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     STH8232_1402 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: CCC20086
UniProt: F8LXU9
Position
complement(1159708..1160727)
Genome map
AA seq 339 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVLKAISEGIEVFGINRGYAGMVEGDIFKLDAKRVENI
LSRGGTFLQSARYPEFAQLEGQLKGIEQLKKYGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATATEALDKIQDTAFSHGRTFVVEVMGRNAGDIALWA
GIASGADQIIVPEEEYDINEVVRKVKEGYESGEKSHHIIVLAEGVMGAEEFAAKMKEAGD
TSDLRATNLGHVIRGGSPTARDRVLASWMGAHAVDLLKEGIGGVAVGIHNEQLVESPILG
TAEEGALFSLTEDGKIIVNNPHKARLDFAELNRSLANLK
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgaccagtggtggagatgcccctggtatgaacgctgccgtt
cgtgcagttgttctcaaagcaatttctgaaggaattgaagtgttcggcattaaccgtgga
tacgccggtatggttgaaggagatatcttcaaacttgatgccaaacgcgtagaaaacatc
cttagccgtggtggcactttccttcagtctgctcgctatcccgagtttgcccaacttgaa
ggtcaacttaaaggtattgagcaacttaaaaaatatggaatcgaaggtgtagttgttatt
ggtggagatggttcttaccatggtgctatgcgtttgactgaacatggtttcccagcagtt
ggtctcccaggaactatcgataacgatatcgttggtacagactatacaattggatttgat
acagccgttgcaactgcaacagaagctttggataaaatccaagatacagctttcagtcat
ggacgtacttttgtcgttgaggtaatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcttcaggtgctgaccaaattattgtgccagaagaagaatatgacatcaacgaa
gtggttcgtaaagttaaagaaggttatgaatctggcgaaaaatctcaccacattattgtg
cttgctgagggcgttatgggtgctgaagagtttgcagctaaaatgaaagaagctggagat
acatcagaccttcgtgctacaaatcttggacacgtaattcgtggtggttcaccaactgca
cgtgaccgtgttcttgcttcatggatgggtgcacatgccgttgatcttcttaaagaagga
attggtggtgttgctgtgggtatccataatgaacagcttgttgaaagtccaatccttggt
acagcagaagaaggtgctttgttcagtcttactgaagacggtaaaattatcgtaaacaat
ccacacaaagctcgccttgattttgcagagcttaaccgttctttagctaacttgaaataa

DBGET integrated database retrieval system