KEGG   Streptococcus thermophilus JIM 8232: STH8232_1768Help
Entry
STH8232_1768      CDS       T02026                                 

Gene name
arcT
Definition
(GenBank) dipeptidase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00790  Folate biosynthesis
stu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STH8232_1768 (arcT)
Enzymes [BR:stu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     STH8232_1768 (arcT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI BCDHK_Adom3
Motif
Other DBs
NCBI-ProteinID: CCC20433
UniProt: F8LYU6
Position
complement(1473851..1474414)
Genome map
AA seq 187 aa AA seqDB search
MENQEKVEQAVYQLLEALGENPEREGLFDTPKRVAKMYAEMFSGLNEDPKDQFTAVFSEV
HDEVVLVKDIPFYSMCEHHLVPFYGMAHVAYLPSGDKVTGLSKLARAVEVAARRPQLQER
LTDQVATALEEALNPRGVFVMVEAEHMCMTMRGIKKPGSKTITTVAKGIYKEDREERKEI
LSLMRDF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaagaaaaagtagaacaagcagtctatcaattattggaagctttgggtgag
aatcctgagcgtgaaggtctttttgatacgccaaaacgtgtggctaagatgtatgctgag
atgttttcaggtttaaatgaagacccgaaagatcagtttacagcggttttttcagaagtt
catgatgaagttgtacttgttaaggatattcctttttactctatgtgtgagcatcacttg
gttcctttttatggcatggctcatgtagcctatttgccaagtggggataaggtgacagga
ctatcaaaattggcacgtgctgttgaagtggcagcccgtcgtccacaattgcaagaacgt
ctcacagatcaagtcgctacagcgcttgaagaagcccttaatcctcgaggggtctttgtt
atggtggaagctgagcacatgtgtatgactatgcgtggtattaaaaaaccaggaagtaag
accatcacaacggttgctaaaggtatctataaagaagaccgtgaagaacgtaaggaaatt
ctttctttgatgcgtgatttttag

DBGET integrated database retrieval system