KEGG   Streptococcus thermophilus JIM 8232: STH8232_1831Help
Entry
STH8232_1831      CDS       T02026                                 

Definition
(GenBank) hypothetical protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
stu  Streptococcus thermophilus JIM 8232
Pathway
stu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
stu01100  Metabolic pathways
stu01110  Biosynthesis of secondary metabolites
stu01130  Biosynthesis of antibiotics
stu01230  Biosynthesis of amino acids
Module
stu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:stu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STH8232_1831
Enzymes [BR:stu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     STH8232_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Tox-MPTase4
Motif
Other DBs
NCBI-ProteinID: CCC20495
UniProt: F8LZ08
Position
complement(1528663..1529430)
Genome map
AA seq 255 aa AA seqDB search
MSKAFLPTILEQKEKEVAQLVMEDLQPLRQTYRLYDFLKSNQNKLQIISEVKKASPSMGD
INLDVDIVAQAKTYEENGAAMISVLTDEVFFKGDISYLKEISTQVAIPTLAKDFIIDEKQ
IVRSRNAGATVILLIVAALPEARLKELYDFATSLGLEVLVETHNLPELEVAHRIGAEIIG
VNNRNLVTFETDINTSLELSTHFKDKPVYISESAIFTGQDAALVAPYFNGILVGTALMTA
DNVAKKVKELQIDKG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcttttcttccaacaatcctagaacaaaaagaaaaagaagtggcccagtta
gtcatggaagacttacagcccttgcgtcagacctatcgcctttatgattttctcaagtca
aatcaaaacaagttgcaaattatttctgaagtgaagaaagccagtccaagtatgggtgat
attaacctagatgtggatattgtagctcaggccaagacctatgaggaaaatggggcagcc
atgatttcagttttgactgacgaagtcttcttcaaaggtgatatttcctatttgaaagaa
atttcgacacaggtagcgattccaaccttggctaaggacttcattattgatgagaaacag
attgtgcgtagccgtaatgcgggtgcgacagtcattctcttgattgtagcggccttgcca
gaagctcgtctcaaggagctctatgattttgcgactagccttggcttggaagtcttggtt
gaaacgcataatctgccagaattggaagtggctcaccgtattggtgctgaaattatcgga
gtaaacaaccgtaatttggtgacatttgagacagatatcaataccagtcttgagttatcg
acgcatttcaaggataaacctgtttatatttctgagtcggctatttttacaggtcaggat
gctgccctagttgccccatattttaatgggattctggtaggaactgcccttatgacggct
gacaatgtagctaaaaaggtcaaggagttgcaaattgacaaaggttaa

DBGET integrated database retrieval system