KEGG   Streptococcus sp. VT 162: V470_00630Help
Entry
V470_00630        CDS       T03287                                 

Definition
(GenBank) rRNA (guanine-N1)-methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
stv  Streptococcus sp. VT 162
Brite
KEGG Orthology (KO) [BR:stv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:stv03009]
    V470_00630
Enzymes [BR:stv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     V470_00630
Ribosome biogenesis [BR:stv03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    V470_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS Methyltransf_32 Methyltransf_8 Methyltransf_4 Methyltransf_18 DUF1726 Ubie_methyltran RRM_1 NPC1_N FmrO MetW
Motif
Other DBs
NCBI-ProteinID: AHZ46961
UniProt: A0A024DBT9
Position
complement(116214..117062)
Genome map
AA seq 282 aa AA seqDB search
MNTNLKPKLQRFASATAFSCPICQENLALVESSLKCSNRHSFDLAKFGYVNLAPQIKQSA
NYDKENFQNRQQILEAGFYQAILEGISDLLTTNPSAKTVLDIGCGEGFYSRKLQESHSDK
TFYAFDISKDSVQIAAKSELNWSVNWFVGDLARLPIKDASMDILLDIFSPANYGEFRRVL
SKDGILIKVIPTENHLKEIRQRVQDQLTNKDYSNQDIKEHFQEYFSIQSIQIASLTKPIT
AEQRQALLSMTPLLFHVDQTKIDWSQLTEITIEAEILVGKAL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaaacctcaaacccaaacttcagcgttttgcttctgcgactgccttttcctgc
cctatctgccaagaaaatctggccttggtagagtctagcctcaagtgtagcaaccgccat
tcttttgatctggcaaaattcggctatgtcaacttggctccgcaaatcaagcaatctgcc
aactacgacaaggaaaacttccaaaaccgccagcaaattcttgaagctggtttttatcag
gctattttagaaggtatctcggacttactaacaactaatccatccgcaaaaacagtcttg
gatatcggttgtggcgaaggtttctactctcgtaaactccaagaaagtcactctgataaa
accttctatgcctttgacatttcaaaagactcggtccaaatcgcagctaaaagtgaactc
aactggtcagttaattggtttgtcggtgacctggctcgacttcctataaaagacgccagt
atggatatcctgctcgacatcttttcacctgccaactatggggaattccgtcgcgtttta
tccaaagatggcatcttgatcaaggtcatcccgactgaaaatcacctcaaagaaatccgt
caaagggtacaagaccagctgacaaacaaggactattccaaccaagatatcaaggaacat
ttccaggaatacttcagcatccaatctatccaaatagcttccctaaccaaacccatcaca
gccgagcaacgccaagctttacttagcatgaccccccttctctttcatgttgaccagacc
aaaattgactggagtcaactgacagagattaccattgaggcagagattttggttgggaaa
gcactgtaa

DBGET integrated database retrieval system