KEGG   Streptococcus sp. VT 162: V470_03700Help
Entry
V470_03700        CDS       T03287                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
stv  Streptococcus sp. VT 162
Pathway
stv00450  Selenocompound metabolism
stv00970  Aminoacyl-tRNA biosynthesis
stv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    V470_03700
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    V470_03700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:stv01007]
    V470_03700
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:stv03016]
    V470_03700
Enzymes [BR:stv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     V470_03700
Amino acid related enzymes [BR:stv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   V470_03700
Transfer RNA biogenesis [BR:stv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    V470_03700
 Prokaryotic type
   Other AARSs
    V470_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AHZ47542
UniProt: A0A024DEM5
Position
768339..770336
Genome map
AA seq 665 aa AA seqDB search
MSEKNFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGYDVFYLTGLDEHGQKIQQK
AEEAGITPQAYVDGMAVGVKELWKLLDISYDKFIRTTDDYHEKVVAQVFERLLAQDDIYL
GEYSGWYSVSDEEFFTESQLAEVFRDEAGNVTGGIAPSGHEVEWVSEESYFLRLSKYQDC
LVEFFKSHPDFITPDGRLNEMLRNFIEPGLEDLAVSRTTFTWGVPVPSNPKHVVYVWIDA
LLNYATALGYGQEDHANYDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDMKLPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERYGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVSMINKYFDGQIPAYVEGVTEFDNALAEVAEQSIAGYHTHMEAVDYPR
ALEAVWTLISRTNKYIDETAPWVLAKDEEHRDQLASVMSHLAASLRVVAHMIEPFMMGTS
RAVLAQLGLAEVSSLENLSLADFPAGVTVVAKGTPIFPRLDMEEEIAYIKEQMEGNKPAV
EKEWNPDEVELKLNKDEIKFEDFDKVEIRVAEVKEVSKVEGSDKLLQFRLDAGDGQDRQI
LSGIAKYYPNEQELVGKKVQIVANLKPRKMMKKYVSQGMILSAEHDGKLTLLTVDPAVPN
GSVIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagaatttttatattacaacaccgatttactatccatctggtaaacttcat
atcggttctgcctacacaaccatcgcttgtgatgtcctagctcgctacaaacgcctcatg
ggctacgatgtcttttatctgactggtcttgatgagcatggtcaaaagattcaacaaaaa
gcagaagaagctgggattacacctcaagcttatgttgatgggatggcggttggagtcaaa
gaactttggaaattattagatatctcatatgataaatttatccgtacaactgatgactac
catgaaaaagtagtcgcacaagtctttgaacgcttgcttgctcaagatgacatctacttg
ggtgaatactctggttggtattcagtttcagatgaggaattctttacagaaagtcaactt
gcagaagtttttcgtgacgaagctggaaatgtgactggtggtattgctccatctggtcac
gaagtagagtgggtttcagaagagtcttatttccttcgcctcagcaaataccaagattgt
ttggtagaatttttcaaatcgcaccctgacttcatcactccagatggtcgtcttaatgaa
atgttgcgtaacttcatcgagccaggtttggaagacttagcggtttctcgtacaaccttt
acctggggtgtgccagtcccttccaatccaaaacacgttgtctacgtttggattgatgcc
cttcttaactatgcgactgctcttggttacggtcaagaggatcatgctaactatgataaa
ttctggaatggaacagtcttccacatggtcggaaaagacattcttcgtttccactccatc
tactggccaatccttctcatgatgttggatatgaaattgcctgaccgcttgattgcccac
ggttggttcgtcatgaaagacggcaagatgtctaagtctaaagggaatgtcgtttaccct
gaaatgttggtagagcgttatggactggatccacttcgttactacctcatgcgtagcctt
ccagtcggttcagatggaaccttcactccagaagactatgtcggccgtatcaactatgaa
ttggccaatgaccttggaaacctccttaaccgtacggtttctatgattaacaagtatttt
gatgggcaaatccctgcctatgtagagggtgtaacagagtttgataatgctcttgctgag
gttgcagaacaatcaatcgcaggctaccatacacacatggaagccgttgattacccacgt
gcccttgaagcagtctggacccttatctctcgcactaacaaatacatcgatgagacagcc
ccatgggtcttggctaaggatgaagagcaccgtgaccaattggcaagtgtcatgagccac
ttggcagccagccttcgtgtcgtagctcacatgattgagccatttatgatgggaactagt
cgcgctgtattggcacaacttggtctagcagaagtttctagcctagaaaacttgagcttg
gcagatttccctgcaggtgtgactgttgttgccaaaggaacaccaatcttcccacgtctc
gacatggaagaagagattgcctatatcaaggaacaaatggaaggcaacaaaccagccgtc
gaaaaagaatggaatccagatgaagttgaactcaaactcaacaaggatgaaatcaagttt
gaagactttgataaggtcgagatccgtgtcgcagaagtcaaagaagtgtctaaagttgaa
ggttctgacaagttgcttcaattccgactagatgctggtgatggtcaagaccgtcaaatc
ctctcaggaattgcaaaatactacccaaacgaacaagaattggtcggcaagaaagtccaa
atcgttgccaacctcaaaccacgcaagatgatgaaaaaatatgtcagtcaaggaatgatc
ctctcagctgaacatgatggcaaattaacccttctaacagttgatccagctgtaccaaac
ggaagtgtgattgggtaa

DBGET integrated database retrieval system